Align glycine betaine/l-proline transport atp-binding protein prov (characterized)
to candidate AZOBR_RS15495 AZOBR_RS15495 ABC transporter ATPase
Query= CharProtDB::CH_001555 (400 letters) >FitnessBrowser__azobra:AZOBR_RS15495 Length = 360 Score = 179 bits (455), Expect = 9e-50 Identities = 99/243 (40%), Positives = 148/243 (60%), Gaps = 4/243 (1%) Query: 27 QGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVL 86 + L+ + + G + V D S+ I GEI + G SG GKS+++R+ L G V Sbjct: 4 EALALNGVTHRYGRVVAVDDVSVTIGAGEIVCLCGPSGCGKSSLLRIAAGLEAVQTGSVR 63 Query: 87 IDGVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGINAEERREKAL 146 I G +A A E R+ + +VFQ +AL PH++VLDN FG L ++ E +R++AL Sbjct: 64 IGGTVVADERGAVPPE--RRGVGLVFQDYALFPHLSVLDNVRFG--LTALSGEAQRKRAL 119 Query: 147 DALRQVGLENYAHSYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDE 206 + L QVG+ YA S+P LSGG +QRV LARALA NP +LL+DE FS LD +R +++DE Sbjct: 120 ETLGQVGMAGYADSFPHHLSGGQQQRVALARALAPNPAVLLLDEPFSGLDARLREQVRDE 179 Query: 207 LVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFR 266 + + ++ + ++HD +EAM + DRIA+M+ G+VVQVG P ++ P N + FF Sbjct: 180 TLHVLKQNGAATMLVTHDPEEAMFLADRIALMRAGKVVQVGNPVDLYTRPVNAFAAEFFG 239 Query: 267 GVD 269 V+ Sbjct: 240 EVN 242 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 360 Length adjustment: 30 Effective length of query: 370 Effective length of database: 330 Effective search space: 122100 Effective search space used: 122100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory