Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate AZOBR_RS15760 AZOBR_RS15760 ATP-binding protein
Query= SwissProt::P17328 (400 letters) >FitnessBrowser__azobra:AZOBR_RS15760 Length = 312 Score = 191 bits (484), Expect = 3e-53 Identities = 105/233 (45%), Positives = 145/233 (62%), Gaps = 6/233 (2%) Query: 32 EQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVD 91 E + ++ G V D SL + GE V++G SGSGKST++R++NRLI P G + ++G D Sbjct: 5 EGVTKRFGAWTAVDDLSLTVAAGEFRVLIGPSGSGKSTVLRMMNRLIAPEAGTIRVEGED 64 Query: 92 IAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQ 151 IA++ E R+++ V QS L PH TV N A +L G R++ + L Sbjct: 65 IARLKP----ETLRRRMGYVIQSVGLFPHWTVERNIAAVPDLLGWPRARVRDRVTELLAL 120 Query: 152 VGL--ENYAHAYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVK 209 + L E Y AYP ELSGG +QRVG+ARALA P ILLMDE FSALDP+ R +Q E+ Sbjct: 121 LNLDPERYRGAYPHELSGGQQQRVGVARALAAEPHILLMDEPFSALDPITRGALQAEMAA 180 Query: 210 LQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVR 262 + TIVF++HD+DEA+ + RIA++ G +VQ GTP +IL +PA+D VR Sbjct: 181 IHKATGTTIVFVTHDMDEALALASRIAVLDRGRLVQSGTPLDILTDPADDRVR 233 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 312 Length adjustment: 29 Effective length of query: 371 Effective length of database: 283 Effective search space: 104993 Effective search space used: 104993 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory