Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate AZOBR_RS19475 AZOBR_RS19475 methionine ABC transporter ATP-binding protein
Query= SwissProt::P17328 (400 letters) >FitnessBrowser__azobra:AZOBR_RS19475 Length = 354 Score = 177 bits (448), Expect = 6e-49 Identities = 97/219 (44%), Positives = 136/219 (62%), Gaps = 1/219 (0%) Query: 46 DASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRR 105 D L I GEI+ I+G SG+GKST++R +N L +PT G+VL+DGVD+ +S ELRE R Sbjct: 25 DIDLTIGRGEIYGIIGRSGAGKSTLLRTVNLLEKPTSGRVLVDGVDVTALSARELREARH 84 Query: 106 KKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGLENYAHAYPDEL 165 I M+FQ F L+ TV DN A +ELAG+A + R L VGL + YP EL Sbjct: 85 S-IGMIFQHFNLLSSRTVFDNVALPLELAGVAKAQIRATVEPLLDLVGLTDKRDRYPAEL 143 Query: 166 SGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDL 225 SGG +QRVG+ARALA P +LL DEA SALDP T++ L + + TIV I+H++ Sbjct: 144 SGGQKQRVGIARALASKPKVLLSDEATSALDPETTTQILHLLADINKRLGLTIVLITHEI 203 Query: 226 DEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTF 264 I ++A+M+NG +++ G +I +P ++ +TF Sbjct: 204 AVIKEICHKVAVMENGRIIEQGPVFDIFAHPKHETTKTF 242 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 354 Length adjustment: 30 Effective length of query: 370 Effective length of database: 324 Effective search space: 119880 Effective search space used: 119880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory