Align Propionyl-CoA carboxylase, biotin carboxylase and biotin-carboxyl carrier subunit; PCC; EC 6.4.1.3; EC 6.3.4.14 (characterized)
to candidate AZOBR_RS12015 AZOBR_RS12015 acetyl-CoA carboxylase biotin carboxylase subunit
Query= SwissProt::I3R7G3 (601 letters) >FitnessBrowser__azobra:AZOBR_RS12015 Length = 447 Score = 461 bits (1185), Expect = e-134 Identities = 220/444 (49%), Positives = 312/444 (70%), Gaps = 1/444 (0%) Query: 1 MFSKVLVANRGEIAVRVMRACEELGVRTVAVYSEADKHGGHVRYADEAYNIGPARAADSY 60 MF KVL+ANRGEIA+R+ RAC E+G++TVAV+S AD HVR ADE+ IGPA A +SY Sbjct: 1 MFEKVLIANRGEIALRIHRACREMGIQTVAVHSTADADAMHVRLADESVCIGPASARESY 60 Query: 61 LDHESVIEAARKADADAIHPGYGFLAENAEFARKVEDSEFTWVGPSADAMERLGEKTKAR 120 L+ +++ AA ADAIHPG GFL+ENA+FA VE+ FT++GP+A+ + +G+K A+ Sbjct: 61 LNIPAILSAASITGADAIHPGIGFLSENAQFAEMVEEHGFTFIGPTAEHIRIMGDKVTAK 120 Query: 121 SLMQDADVPVVPGTTEPADSAEDVKAVADDYGYPVAIKAEGGGGGRGLKVVHSEDEVDGQ 180 + + +PVVPG+ P + E+ + + + GYP+ IKA GGGG+G+KV + D++ Sbjct: 121 KTVMEQGLPVVPGSDGPVPTLEEAEKIGRETGYPILIKAAAGGGGKGMKVARNPDQLKEA 180 Query: 181 FETAKREGEAYFDNASVYVEKYLEAPRHIEVQILADEHGNVRHLGERDCSLQRRHQKVIE 240 ++ A+ E A F N VY+EKYL PRHIE+Q+L DEHGN H GERDCS+QRRHQKVIE Sbjct: 181 YQLARGEARAAFGNDEVYIEKYLGKPRHIEIQLLGDEHGNCVHFGERDCSVQRRHQKVIE 240 Query: 241 EAPSPALSEDLRERIGEAARRGVRAAEYTNAGTVEFLVEDGEFYFMEVNTRIQVEHTVTE 300 EAPSPAL+ + R IG+ A + A Y GT+EFL EDG+FYF+E+NTR+QVEHT+TE Sbjct: 241 EAPSPALNAEQRAFIGDLAAKTAAAIGYRGVGTMEFLFEDGQFYFIEMNTRLQVEHTITE 300 Query: 301 EVTGLDVVKWQLRVAAGEELDFSQDDVEIEGHSMEFRINAEAPEKEFAPATGTLSTYDPP 360 +TG+D+V+ Q+RVA G L + Q D+ +GHS+E R+NAE PE F P+ G + Y P Sbjct: 301 MITGIDLVREQIRVATGAPLGYGQADIRFQGHSIECRVNAEHPE-TFIPSPGKIDGYHAP 359 Query: 361 GGIGIRMDDAVRQGDEIGGDYDSMIAKLIVTGSDREEVLVRAERALNEFDIEGLRTVIPF 420 GG+G+R+D A+ G I YDS+IAKL+V G+ R E L+R R + E+ I G+ T +P Sbjct: 360 GGLGVRVDSALYDGYRIPPHYDSLIAKLVVHGTTRNECLMRLRRTIEEYVIGGVDTTLPL 419 Query: 421 HRLMLTDEAFREGSHTTKYLDEVL 444 H+ ++ +AF +G++ +L++++ Sbjct: 420 HQRIIAQQAFIDGNYDIHWLEQLM 443 Lambda K H 0.312 0.132 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 670 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 601 Length of database: 447 Length adjustment: 35 Effective length of query: 566 Effective length of database: 412 Effective search space: 233192 Effective search space used: 233192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory