GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pccA in Azospirillum brasilense Sp245

Align Propionyl-CoA carboxylase alpha chain; EC 6.4.1.3 (characterized)
to candidate AZOBR_RS22285 AZOBR_RS22285 3-methylcrotonyl-CoA carboxylase subunit alpha

Query= SwissProt::Q5LUF3
         (681 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS22285 AZOBR_RS22285
           3-methylcrotonyl-CoA carboxylase subunit alpha
          Length = 667

 Score =  539 bits (1389), Expect = e-157
 Identities = 311/702 (44%), Positives = 421/702 (59%), Gaps = 62/702 (8%)

Query: 1   MFNKILIANRGEIACRVIKTARKMGISTVAIYSDADKQALHVQMADEAVHIGPPPANQSY 60
           MF+KILIANRGEIACRVI+TAR+MGI TVA+YS+AD +A+HV+MADEAV IGP P  +SY
Sbjct: 1   MFDKILIANRGEIACRVIRTARRMGIRTVAVYSEADARAMHVEMADEAVCIGPAPVGESY 60

Query: 61  IVIDKVMAAIRATGAQAVHPGYGFLSENSKFAEALEAEGVIFVGPPKGAIEAMGDKITSK 120
           +  D ++   + TGAQA+HPGYGFLSEN+ FA A    GV+F+GPP  AI  MG K  SK
Sbjct: 61  LRGDAILEVAKRTGAQAIHPGYGFLSENAGFAAACAEAGVVFIGPPIEAIRVMGSKAESK 120

Query: 121 KIAQEANVSTVPGYMGLIEDADEAVKISNQIGYPVMIKASAGGGGKGMRIAWNDQEAREG 180
           ++  +A+V  VPG+ G  +D +     + +IGYPV++KASAGGGGKGMR+     E  + 
Sbjct: 121 RVMSQADVPLVPGFHGEAQDLETLSAEAERIGYPVLVKASAGGGGKGMRVVRAAGEFADA 180

Query: 181 FQSSKNEAANSFGDDRIFIEKFVTQPRHIEIQVLCDSHGNGIYLGERECSIQRRNQKVVE 240
              +K EA  +FGDD + +EK++ +PRH+EIQV CD+HGNG+YL ER+CSIQRR+QKV+E
Sbjct: 181 VAGAKREAKAAFGDDSVLLEKYLGRPRHVEIQVFCDTHGNGVYLFERDCSIQRRHQKVIE 240

Query: 241 EAPSPFLDEATRRAMGEQAVALAKAVGYASAGTVEFIVDGQKNFYFLEMNTRLQVEHPVT 300
           EAP+P L +  RR MGE AVA AKAV Y  AGTVEF+ +    FYF+EMNTRLQVEHPVT
Sbjct: 241 EAPAPALPDDLRRRMGEAAVAAAKAVNYVGAGTVEFLYE-DGGFYFIEMNTRLQVEHPVT 299

Query: 301 ELITGVDLVEQMIRVAAGEPLSITQGDVKLTGWAIENRLYAEDPYRGFLPSIGRLTRYRP 360
           E ITG DLVE  +RVAAG  L + Q  +   G A E RLYAEDP R FLP+IG+L R RP
Sbjct: 300 EKITGQDLVEWQLRVAAGGVLPLMQDQLTRRGHAFEARLYAEDPQREFLPAIGKLVRLRP 359

Query: 361 PAETAAGPLLVNGKWQGDAPSGEAAVRNDTGVYEGGEISMYYDPMIAKLCTWAPTRAAAI 420
           PAE                      VR DTGV EG E++M+YDPMIAKL  W   R AA+
Sbjct: 360 PAE-------------------NEHVRVDTGVREGDEVTMFYDPMIAKLIVWDEDRDAAL 400

Query: 421 EAMRIALDSFEVEGIGHNLPFLSAVMDHPKFISGDMTTAFIAEEYPEGF-EGVNLPETDL 479
             +R+AL ++EV G+  N+ FL A+  HP F + ++ T FI     +       +P+  L
Sbjct: 401 RRLRVALAAYEVVGVTTNVAFLGAIAGHPAFRAVEIDTGFIERHRADLLPPPAPVPDRGL 460

Query: 480 RRVAAAAAAMHRVAEIRRTRVSGRMDNHERRVGTEWVVTLQGADFPVTIAADHDGSTVSF 539
             +AA +  + R A+ R+ R         R     W   L  + + +     HD   +  
Sbjct: 461 -AIAALSVLLRRNADTRKAR---------RAASDPWSPWLSASGWRLNDDNHHDLRLMDG 510

Query: 540 D-----------DGSSMRVTSDWTPGDQLANLMVDGAPLVLKVGKISGGFRIRTRGADL- 587
           D           DG  + V  +  P  +   + +DG  L   +  +     +  +G DL 
Sbjct: 511 DTPRALTLHFRPDGYEIEV--EGRPAIRAERVTLDGETLTATIDAVRTRATVVCQGLDLT 568

Query: 588 --------KVHVRTPRQAELARLMPEKLPPDTSKMLLCPMPGLIVKVDVEVGQEVQEGQA 639
                   ++H+  P     AR   ++     S  L  PMPG +V+V VE GQ V+ G  
Sbjct: 569 ILSDGAVWRLHLDDP----TARAAEQE---GGSGRLTAPMPGTVVRVLVEPGQTVEAGAP 621

Query: 640 LCTIEAMKMENILRAEKKGVVAKINASAGNSLA--VDDVIME 679
           L  +EAMKME+ ++A   G V+ +N +AG+ ++  VD ++++
Sbjct: 622 LMLLEAMKMEHTIKAPAAGTVSAVNFAAGDQVSEGVDLLVLD 663


Lambda     K      H
   0.317    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1182
Number of extensions: 53
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 681
Length of database: 667
Length adjustment: 39
Effective length of query: 642
Effective length of database: 628
Effective search space:   403176
Effective search space used:   403176
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory