Align acyl-CoA oxidase (EC 1.3.3.6) (characterized)
to candidate AZOBR_RS19670 AZOBR_RS19670 acyl-CoA dehydrogenase
Query= BRENDA::Q96329 (436 letters) >FitnessBrowser__azobra:AZOBR_RS19670 Length = 400 Score = 254 bits (648), Expect = 4e-72 Identities = 142/377 (37%), Positives = 212/377 (56%), Gaps = 1/377 (0%) Query: 52 NDLLTPEEQAIRKKVRECMEKEVAPIMTEYWEKAEFPFHITPKLGAMGVAGGSIKGYGCP 111 ++ LT +E+ IR R + ++ P +TE F I ++G +G G +I GYGC Sbjct: 24 DEQLTEDERMIRDAARSYCQDKLLPRVTEANRHEIFHREIMNEMGELGFLGSTIDGYGCA 83 Query: 112 GLSITANAIATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEKYLPSLAQLNTVAC 171 G++ + + E+ RVD+ + + V SSL M I GS+ Q+EKYLP LA + C Sbjct: 84 GVNYVSYGLVAREVERVDSGYRSAMSVQSSLVMHPIYAYGSDVQREKYLPKLATGEWIGC 143 Query: 172 WALTEPDNGSDASGLGTTATKVEGGWKINGQKRWIGNSTFADLLIIFARNTTTNQINGFI 231 + LTEPD GSD +G+ T A KV G+ ++G K WI NS AD+ +++A+N +INGF+ Sbjct: 144 FGLTEPDAGSDPAGMKTRARKVADGYIVSGAKMWITNSPVADVFVVWAKNDE-GKINGFV 202 Query: 232 VKKDAPGLKATKIPNKIGLRMVQNGDILLQNVFVPDEDRLPGVNSFQDTSKVLAVSRVMV 291 ++K GL A KI K LR G+I++ VFVP+E+RLP + L +R + Sbjct: 203 LEKGMKGLSAPKIEGKFSLRASATGEIVMDEVFVPEENRLPNIEGIVGPFGCLNRARYGI 262 Query: 292 AWQPIGISMGIYDMCHRYLKERKQFGAPLAAFQLNQQKLVQMLGNVQAMFLMGWRLCKLY 351 AW +G + + +Y +RKQFG PLAA Q+ Q KL M + ++ +L Sbjct: 263 AWGAMGAAEFCFHAARQYQIDRKQFGRPLAANQIPQLKLANMQTEIALGLQAALQVGRLL 322 Query: 352 ETGQMTPGQASLGKAWISSKARETASLGRELLGGNGILADFLVAKAFCDLEPIYTYEGTY 411 + G+ P SL K KA E A + R++ GGNGI +F V + +LE + TYEGT+ Sbjct: 323 DDGKAAPEMISLIKRNNCGKALEIARVARDMHGGNGIADEFHVIRHVMNLEAVNTYEGTH 382 Query: 412 DINTLVTGREVTGIASF 428 DI+ L+ GR +TGI +F Sbjct: 383 DIHALILGRAITGIQAF 399 Lambda K H 0.319 0.133 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 400 Length adjustment: 32 Effective length of query: 404 Effective length of database: 368 Effective search space: 148672 Effective search space used: 148672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory