GapMind for catabolism of small carbon sources

 

Aligments for a candidate for prpE in Azospirillum brasilense Sp245

Align Propionate--CoA ligase (EC 6.2.1.17) (characterized)
to candidate AZOBR_RS06340 AZOBR_RS06340 acyl-CoA synthetase

Query= reanno::Phaeo:GFF1175
         (629 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS06340 AZOBR_RS06340 acyl-CoA
           synthetase
          Length = 640

 Score =  898 bits (2321), Expect = 0.0
 Identities = 426/627 (67%), Positives = 500/627 (79%)

Query: 3   YSEVYEGWKANPEQFWMEAAEAISWDSAPTKALTDKGDGLYEWFADARVNTCYNAVDRHV 62
           Y++++    ++P+ FW EAAE I+W     K L D     Y WF    +NTCYNAVDRHV
Sbjct: 9   YNQIHARSLSDPDGFWGEAAEDITWIKRWDKVLDDSNAPFYRWFTGGVLNTCYNAVDRHV 68

Query: 63  EQGRGEQTAIIYDSPITHTKREISYVELRNRVATLAGALRAKGVEKGDRVIIYMPMIPEA 122
           E GRG Q AIIYDSP+T T + I+Y E +++VA  AGALRA+GVEKGDRVI+YMPMIP++
Sbjct: 69  EAGRGAQAAIIYDSPVTKTVQTITYAEFQDQVARFAGALRAQGVEKGDRVILYMPMIPQS 128

Query: 123 LEAMLACARLGAVHSVVFGGFAANELAVRIDDATPKAIIAASCGLEPGRTVHYKPLLDGA 182
           L AMLACARLGAVHSVVFGGFA +ELA RI+D+ PKAI++ASCG+EP R V YKP+LD A
Sbjct: 129 LVAMLACARLGAVHSVVFGGFAPHELATRINDSRPKAIVSASCGIEPNRVVKYKPMLDAA 188

Query: 183 IDLATHKPDFCVIFQREQEVAELIEGRDVNWHGFQYGVEPAECVPVEGNHPAYILYTSGT 242
           I+ A HKP   ++FQR QE A L+EGRDV+W       EPAECVPV    P YILYTSGT
Sbjct: 189 IEQAEHKPSSVIVFQRPQETATLVEGRDVDWAEAVAKAEPAECVPVAATDPLYILYTSGT 248

Query: 243 TGQPKGVIRHTAGQLVALNWTMKNIYNVDPGDVFWAASDVGWVVGHSYICYGPLIHGNTT 302
           TGQPKGVIR   G  VAL WTMKNIYNV+PG+V+WAASDVGWVVGHSYI YGPL+HG TT
Sbjct: 249 TGQPKGVIRDNGGHAVALKWTMKNIYNVEPGEVYWAASDVGWVVGHSYIVYGPLLHGCTT 308

Query: 303 IVFEGKPIGTPDAGTFWRVISEHKVKSFFTAPTAFRAVKREDPKGEFVKKYDLSCLKQVY 362
           +VFEGKP+GTPDAGTFWRVI +HK+ + FTAPTAFRA+KREDP  E +KKYDLS  + ++
Sbjct: 309 VVFEGKPVGTPDAGTFWRVIEQHKIGTLFTAPTAFRAIKREDPNAELLKKYDLSHFRALF 368

Query: 363 LAGERADPDTITWAQEQLKVPVIDHWWQTETGWSIAANPLGIEELPTKLGSPAVPMPGYT 422
           LAGER+DPDT+ WA++ L VPVIDHWWQTETGW+I+ NPLG+   P K GS   PMPG+ 
Sbjct: 369 LAGERSDPDTLHWAEDNLNVPVIDHWWQTETGWAISGNPLGVHLFPIKYGSATRPMPGWD 428

Query: 423 VDILDEGGHPVAPGELGAIAVKLPLPPGTLPTLWNAEDRFKKSYLTTFPGYYETGDAGMK 482
           V IL+     V  G++GAI VKLPLPPGTLPTLWNA+DR++KSYL+ +PGYY+TGDAG  
Sbjct: 429 VQILNAENKEVPRGDIGAICVKLPLPPGTLPTLWNADDRYRKSYLSDYPGYYQTGDAGFI 488

Query: 483 DEDGYLYIMARTDDVINVAGHRLSTGAMEEVLAGHPDVAECAVIGVSDSLKGQAPVGFLC 542
           D+DGY+YIMARTDD+INVAGHRLSTG MEEVLA H DVAECAVIGV+D LKGQ P+GFLC
Sbjct: 489 DDDGYVYIMARTDDIINVAGHRLSTGGMEEVLASHKDVAECAVIGVADDLKGQVPLGFLC 548

Query: 543 LNAGCDTPHEDVVAQVVKLVREKIGPVAAFKLACVVDRLPKTRSGKILRGTMVNIADGTD 602
           L AG   PHE++V +VV+LVRE+IGPVA FK A VV+RLPKTRSGKILRGTM  IAD  D
Sbjct: 549 LKAGVTRPHEEIVKEVVQLVREQIGPVADFKRAVVVERLPKTRSGKILRGTMQKIADNQD 608

Query: 603 WKMPATIDDPAILDEITTALQGLGYAK 629
           +K PATIDDP IL EI  ALQ LGYAK
Sbjct: 609 YKTPATIDDPGILPEIAEALQSLGYAK 635


Lambda     K      H
   0.318    0.137    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1404
Number of extensions: 54
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 629
Length of database: 640
Length adjustment: 38
Effective length of query: 591
Effective length of database: 602
Effective search space:   355782
Effective search space used:   355782
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory