Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate AZOBR_RS27845 AZOBR_RS27845 polyamine ABC transporter ATPase
Query= TCDB::P31134 (377 letters) >FitnessBrowser__azobra:AZOBR_RS27845 Length = 365 Score = 264 bits (674), Expect = 3e-75 Identities = 150/343 (43%), Positives = 205/343 (59%), Gaps = 15/343 (4%) Query: 4 AIPRPQAKTRKALTPLLEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLR 63 A P+P A LL IR++ K + HA+ DVSL + GE ALLG SGCGK+TLLR Sbjct: 3 ATPKPDA--------LLSIRSIDKYFGTYHALRDVSLDVAHGEFVALLGPSGCGKTTLLR 54 Query: 64 MLAGFEQPSAGQIMLDGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPK 123 +AGF P +G I + G D++++PP+ RP+N +FQ YALFPH+++ N+A+G ++ + + Sbjct: 55 CIAGFLSPDSGTIRIGGEDVTRLPPHRRPLNTVFQHYALFPHLSILDNVAYGPRRHGVAR 114 Query: 124 AEIASRVNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKK 183 E R E L LV + A R P +LSGGQ+QRVALAR+ RPKLLLLDEP+ ALD K Sbjct: 115 GEALERAREALELVGLDSAAGRHPRELSGGQQQRVALARAFVNRPKLLLLDEPLSALDLK 174 Query: 184 LRDRMQLEVVDILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTT 243 LR RMQ+E+ + E++G+ V VTHDQEEAM+MA RI +MNRG Q+G+ IY P + Sbjct: 175 LRKRMQIELKHLQEKLGIAFVFVTHDQEEAMSMANRIVVMNRGVIEQVGDGRAIYTRPAS 234 Query: 244 RYSAEFIGSVNVFEGVLKERQEDGLVLDSPGLVHPLKVDADASVVDNVPVHVALRPEKIM 303 R+ A+FIG N+ G + L + S L H + AD LRPE + Sbjct: 235 RFVADFIGEANLLPGTAEGDAGVRLAVGSALLPH---LGADT----RQRYTAVLRPEHVE 287 Query: 304 LCEEPPANGCNFAVGEVIHIAYLGDLSVYHVRLKSGQMISAQL 346 L +EP A G G V + G +V VR+ + S +L Sbjct: 288 LLKEPEAPGLITDQGFVEDVIDTGGQTVVTVRVGEHLLASRRL 330 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 365 Length adjustment: 30 Effective length of query: 347 Effective length of database: 335 Effective search space: 116245 Effective search space used: 116245 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory