Align Putrescine transport system permease protein PotI (characterized)
to candidate AZOBR_RS25325 AZOBR_RS25325 polyamine ABC transporter permease
Query= SwissProt::P0AFL1 (281 letters) >FitnessBrowser__azobra:AZOBR_RS25325 Length = 268 Score = 138 bits (347), Expect = 1e-37 Identities = 87/238 (36%), Positives = 134/238 (56%), Gaps = 14/238 (5%) Query: 22 FLYAPMLMLVIYSFNSSKLVTVW--AGWSTRWYGELLRDDAMMSAVGLSLTIAACAATAA 79 FL AP+L++ S ++ ++ W +GWS RWY LL D AM +A+ SL +AA A Sbjct: 20 FLLAPVLLVFPMSLSADADLS-WPPSGWSLRWYVALLADGAMAAALINSLLLAAAVTALA 78 Query: 80 AILGTIAAVVLVRFGRFRGSNGFAFMITAPLVMPDVITGLSLLLLFVALAHAIGWPADRG 139 ++ AA+ L R GR A ++T PL++P ++ GL+LL+LFV L WP G Sbjct: 79 LLIAFPAALALAR-GRL---TALAVLLTLPLLLPSIVLGLALLVLFVRLGLVGSWP---G 131 Query: 140 MLTIWLAHVTFCTAYVAVVISSRLRELDRSIEEAAMDLGATPLKVFFVITLPMIMPAIIS 199 M + H+ Y V+ + LR L +EEAA LGA P V ITLP+ P + + Sbjct: 132 MA---VPHLLITLPYALRVLETALRGLPPGVEEAAASLGARPASVALRITLPLAAPGLAA 188 Query: 200 GWLLAFTLSLDDLVIASFVSGPGATTLPMLVFSSVRMGVNPEINALAT-LILGAVGIV 256 +L F +S D++V++ F++GP TTLP+ ++ V +P + A+A L+LG + +V Sbjct: 189 AAILVFLVSFDEVVVSLFIAGPRLTTLPVALYRHVESSSDPLVAAVAALLVLGTLALV 246 Lambda K H 0.330 0.140 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 268 Length adjustment: 25 Effective length of query: 256 Effective length of database: 243 Effective search space: 62208 Effective search space used: 62208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory