GapMind for catabolism of small carbon sources

 

Aligments for a candidate for dctM in Azospirillum brasilense Sp245

Align TRAP C4-dicarboxylate transport system permease, DctM-2 subunit, component of The 2-ketomonocarboxylate transporter (presented in order of affinity - 2-oxovalerate [highest affinity, KD=0.1 μM], 2-oxoisovalerate, 2-oxobutyrate, 2-oxoisocaproate, 2-oxo-3-methylvalerate, pyruvate [lowest affinity, KD=3 μM]) (characterized)
to candidate AZOBR_RS29760 AZOBR_RS29760 C4-dicarboxylate ABC transporter

Query= TCDB::D5ATK1
         (611 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS29760 AZOBR_RS29760
           C4-dicarboxylate ABC transporter
          Length = 596

 Score =  660 bits (1703), Expect = 0.0
 Identities = 362/597 (60%), Positives = 443/597 (74%), Gaps = 66/597 (11%)

Query: 10  MAPIMFVSLIVFLLLGYPVAFSLAANGLVFFIIGVELAPLSGGSINLDWPLLNAMPERFW 69
           MAPIMF +L+  LLLGYPVAF+LAANGL+F +IG+E+     G    D  L  A+PER +
Sbjct: 1   MAPIMFATLVGMLLLGYPVAFALAANGLLFGLIGIEI-----GLFRPD--LFQALPERVY 53

Query: 70  GVLSNETLLAIPFFTFMGILLEKSGMAEDLLDTIGQLFGPIRGGLAYAVILVGALLAATT 129
           G ++N+ LLA+PFFTFMG++LE+SGMAEDLLDTIGQLFG IRGGLAYAVI VGALLAATT
Sbjct: 54  GTMNNDVLLAVPFFTFMGLVLERSGMAEDLLDTIGQLFGSIRGGLAYAVIFVGALLAATT 113

Query: 130 GVVAASVIAMGLISLPIMLRYGYDRRIASGVIAASGTLAQIIPPSLVLIVLADQLGRSVG 189
           GVVAASVI+MGLISLPIMLRYGYDRR+ASGVIAASGTLAQIIPPSLVLIV+ADQLGRSVG
Sbjct: 114 GVVAASVISMGLISLPIMLRYGYDRRLASGVIAASGTLAQIIPPSLVLIVMADQLGRSVG 173

Query: 190 DMYKGALIPGLVLTGLYMLYVLVMSILRPNSMPALPKEA---------RTLGQ-GVLSFF 239
           DMY+ A IPGL+L GLY LYV V+S++ P + P LP EA         R + Q G+L+ F
Sbjct: 174 DMYEAAFIPGLLLAGLYALYVFVVSMIWPKAAPGLPPEAIAHREPNGARGVWQLGLLALF 233

Query: 240 --------------------VAMGIGIAIFVA--AQHWLAGTGAAK-------NAGILAA 270
                               V + + +A+ VA  A  +  G GA +        A + AA
Sbjct: 234 SGAVATWVMGRTDVKSGADYVVLLLSVAVLVAFLAAAFNRGFGAQRLVLQTVATAALTAA 293

Query: 271 -----------------SIAV--IFVYVMALIDKATGLDRMSHLAQQVIIVLIPPLALIF 311
                            SIA   ++   +A++++ATG   +S +A+Q   V++PPLALIF
Sbjct: 294 AAWLTVNEWTTLALIGDSIAAGALYALAVAVVERATGRRLISRMAEQATFVMVPPLALIF 353

Query: 312 LVLGTIFLGIATPTEGGAMGAVGALILSAVKKRLSLEVVREALAATTRLSAFVMFILLGA 371
           LVLGTIF+G+ATPTEGGAMGAVGAL L+A+KKRL+ ++VR+A  +T +L+AFV+FIL+GA
Sbjct: 354 LVLGTIFIGLATPTEGGAMGAVGALALAAMKKRLNFDMVRQATYSTAKLAAFVLFILIGA 413

Query: 372 RVFSLTFYGVNGHIWVEHLLVSLPGGETGFLIFVSLLVFFLAFFLDFFELAFIIVPLLVA 431
           RVFSLTFYGVNGHIWVE L+VSLPGG+ GFLI VS++VF LAFFLDFFELAFI++PLL  
Sbjct: 414 RVFSLTFYGVNGHIWVEELMVSLPGGQMGFLIAVSVMVFLLAFFLDFFELAFIVIPLLAP 473

Query: 432 PAEALGIDLIWFGVILGVNMQTSFMHPPFGFALFFLRSVAPKVPFLDKVTGKLTEPVKTS 491
            A+ LGIDL+WFGVIL VNMQTSFMHPPFGF+LFFLRSVAPK+P++D++T K T PV TS
Sbjct: 474 AADRLGIDLVWFGVILAVNMQTSFMHPPFGFSLFFLRSVAPKLPYIDRITKKETAPVLTS 533

Query: 492 QIYWGAVPFVCIQIVMIAVVIAFPQLVMHYKGKPVDVSHVTVTVP-GGIGGGLGGGL 547
           QIYWGAVPFV IQ+VM+A+VIAFPQ+VMHYK     +    +     G+GG L   L
Sbjct: 534 QIYWGAVPFVVIQLVMVALVIAFPQMVMHYKSTATKLDDKQIEEQFKGLGGDLNDDL 590


Lambda     K      H
   0.327    0.146    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1017
Number of extensions: 56
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 611
Length of database: 596
Length adjustment: 37
Effective length of query: 574
Effective length of database: 559
Effective search space:   320866
Effective search space used:   320866
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory