Align TRAP dicarboxylate transporter, DctP-2 subunit, component of The 2-ketomonocarboxylate transporter (presented in order of affinity - 2-oxovalerate [highest affinity, KD=0.1 μM], 2-oxoisovalerate, 2-oxobutyrate, 2-oxoisocaproate, 2-oxo-3-methylvalerate, pyruvate [lowest affinity, KD=3 μM]) (characterized)
to candidate AZOBR_RS20010 AZOBR_RS20010 ABC transporter substrate-binding protein
Query= TCDB::D5ALT6 (365 letters) >FitnessBrowser__azobra:AZOBR_RS20010 Length = 365 Score = 445 bits (1144), Expect = e-129 Identities = 210/356 (58%), Positives = 260/356 (73%), Gaps = 1/356 (0%) Query: 1 MDRRSFLTKAAIGGAAATTLATPALAQSMPKVTWRLTSSFPKSLDTIYGGAEVLSKMVSE 60 M RR+F+T A +G AA+TLA PA+AQS P++ WR SSFPKSLDTIYGGAE ++K V+E Sbjct: 1 MKRRTFITSAGVG-VAASTLAAPAIAQSNPEIKWRCASSFPKSLDTIYGGAERVAKRVAE 59 Query: 61 ASDGNFQIQVFAAAEIVPGLQAADATAAGTVEACHTVGYYYWGKDPAWALGAAVPFGLSA 120 ++G FQI+ FA+ EIVPGLQ DA GTVE HTV YYY GKDP +A AA+PFGL+A Sbjct: 60 MTEGKFQIRTFASGEIVPGLQVLDAVKDGTVECGHTVSYYYVGKDPTFAFDAAMPFGLNA 119 Query: 121 RGMNAWQYHGGGIDLYNEFLATQGLIGFPGGNTGAQMGGWFRKEINTVADLSGLKMRVGG 180 R NAW HGGG++L EF ++ F GNTG QMGGWFR E+ TV DL GLK R+GG Sbjct: 120 RQQNAWMTHGGGMELMREFFKGYNIVQFAAGNTGTQMGGWFRNELKTVEDLKGLKFRIGG 179 Query: 181 FAGKVMEKLGLVPQQVAGGDIYPALEKGTLDATEWVGPYDDEKLGFYKVAPYYYYPGWWE 240 +AG ++++LG+VPQQ+AGGDIYPALEKGT+DA EWVGPYDDEKLGF KVA YYYYPGWWE Sbjct: 180 YAGTILQRLGVVPQQIAGGDIYPALEKGTIDAAEWVGPYDDEKLGFNKVAKYYYYPGWWE 239 Query: 241 GGPTVHFMFNKAAYEGLPKAYQALLRTACQAEDADMLQKYDYKNPLALKSLVANGAQLRP 300 GGP V F+ + +E LPK YQA+L AC ADM+ KYD N ALK LV G L+P Sbjct: 240 GGPQVSFLVSLPQWEQLPKHYQAILEAACADATADMVGKYDVVNMHALKRLVGAGTVLKP 299 Query: 301 FSQEILEACFNAAQEVYAEMTATNPAFKKIYDSMVAFRADHYLWTQVAEYNYDTFM 356 + ++IL+AC+ A +VY E A N F+K+Y+ FR + YLW +VAE +D F+ Sbjct: 300 YPRDILQACYQATFDVYEEEAAKNEKFRKVYEQWRKFRDEEYLWFRVAENTFDNFV 355 Lambda K H 0.319 0.134 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 365 Length adjustment: 30 Effective length of query: 335 Effective length of database: 335 Effective search space: 112225 Effective search space used: 112225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory