Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate AZOBR_RS29670 AZOBR_RS29670 ABC transporter permease
Query= TCDB::P21627 (307 letters) >FitnessBrowser__azobra:AZOBR_RS29670 Length = 290 Score = 189 bits (479), Expect = 9e-53 Identities = 108/297 (36%), Positives = 168/297 (56%), Gaps = 13/297 (4%) Query: 7 YLQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLAMMGLD 66 +LQ L+N + +G TYAL+ IG T+++GI+ ++NF HGE+Y G+Y+A++ L MMGL+ Sbjct: 4 HLQHLLNAVVLGGTYALLGIGLTLIFGIMRVVNFTHGELYTFGAYMAYM---LAGMMGLN 60 Query: 67 SVPLMMLAAFAASIIVTSAFGYSIERVAYRPLRGGNRLIPLISAIGMSIFLQNAVMLSQD 126 + +AA ++ A G IE RPL+G + ++ IG I +Q L Sbjct: 61 FFMSLAMAA-----VLGMALGALIEFTLLRPLKGADIDTTMLVMIGAGIAMQAGEQLVWG 115 Query: 127 SKEKAIPTLLPGNFVFGESSMNGVVISYMQILIFVVTFLVMFGLTLFISRSRLGRACRAC 186 K++P+ P V + V + ++ + V L++ G L I+R++LG A RA Sbjct: 116 GVAKSVPSPFPTEPVV----LGSVSVGMNRLFVLGVALLLLGGFYLLINRTKLGVAMRAT 171 Query: 187 AEDLKMTNLLGINSNNIIALTFVIGAALAAVAAVLLGMQYGVINPGIGFLAGIKAFTAAV 246 +D L+G+N + LTF +G+ LAA A LLG + V+ P +G L +KAF + Sbjct: 172 FQDPDTAALMGVNRGLMYTLTFALGSGLAATAGALLGPIF-VVTPTMGDLVALKAFAIVI 230 Query: 247 LGGIGSIPGAMLGGLLLGVAEAFGADVFGDQYKDVVAFGLLILVLLFRPTGILGRPE 303 LGG+G+IPGA +GG +L +AE FGA Y+D + F L+I VL+ RP G+ E Sbjct: 231 LGGLGNIPGATIGGFVLALAEEFGAGYLSSGYRDAMGFLLIIAVLIVRPQGLFAMKE 287 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 290 Length adjustment: 27 Effective length of query: 280 Effective length of database: 263 Effective search space: 73640 Effective search space used: 73640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory