Align L-serine ammonia-lyase (EC 4.3.1.17) (characterized)
to candidate AZOBR_RS06795 AZOBR_RS06795 serine/threonine dehydratase
Query= BRENDA::A0QY48 (316 letters) >FitnessBrowser__azobra:AZOBR_RS06795 Length = 331 Score = 220 bits (560), Expect = 4e-62 Identities = 143/318 (44%), Positives = 184/318 (57%), Gaps = 13/318 (4%) Query: 8 DISGAAARIAADIVRTPLLAADWGDPRCP--LWLKAETLQPIGAFKIRGAFNALGRLDTH 65 DI AAAR+ VRTPLL + R + LK E LQ G+FK RGAFN L +L Sbjct: 13 DIVEAAARLDGFAVRTPLLENALLNERVGGRVLLKPEVLQRSGSFKFRGAFNRLSQLTPE 72 Query: 66 TRARGVVAYSSGNHAQAVAYAAAAYGVPAHIVMPEETPAVKVEATRRRGAHVVLCG--AG 123 R GVVA+SSGNHAQ VA AAA G+PA IVMP + PA+K+ TR GA VVL Sbjct: 73 ERRGGVVAWSSGNHAQGVAAAAALLGMPAVIVMPSDAPALKIANTRGYGAEVVLYDRWTE 132 Query: 124 ERERTAAELVEKTGAVLIPPFDHPDIIAGQGTIGIEIAEDLPELAT----VLIPVSGGGL 179 RE A + E+ GA +PP+DHP I+AGQGT+G+EIA + V+ P SGGGL Sbjct: 133 SREAIATAIAEERGAATVPPYDHPQIMAGQGTVGLEIAAQAQAIGAVPDDVIAPCSGGGL 192 Query: 180 ASGIGTAIRALRPKAKIFAVEPELAADTAESLALGSIVEWPVAKRNRTIADGLRS-TPSE 238 SG+ TA+R P A+++A EP D A SLA G VE A R+I D L + TP Sbjct: 193 MSGVATAVRHSFPDARLWAAEPAGFDDVARSLAAGERVE--NAAGQRSICDALLTPTPGA 250 Query: 239 LTFAHLRQVIDDVITVSEDEIRSAVRELALRARLVAEPSGAVSLAGYRKAALP-DGSAVA 297 LTF ++ ++ + V++ E+++A+ +LV EP GAV LA LP G VA Sbjct: 251 LTFPVMKDLLSGSLAVTDAEVKAAMAYAFTVLKLVVEPGGAVGLAAVLTGKLPAAGRTVA 310 Query: 298 IV-SGGNIEPAQLAAILA 314 +V SGGN++ A LA Sbjct: 311 VVLSGGNVDAATFTDALA 328 Lambda K H 0.318 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 331 Length adjustment: 28 Effective length of query: 288 Effective length of database: 303 Effective search space: 87264 Effective search space used: 87264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory