Align Organic acid uptake porter, DctA of 444 aas and 8 - 10 putative TMSs (characterized)
to candidate AZOBR_RS28110 AZOBR_RS28110 C4-dicarboxylate ABC transporter
Query= TCDB::Q848I3 (444 letters) >FitnessBrowser__azobra:AZOBR_RS28110 Length = 457 Score = 462 bits (1190), Expect = e-135 Identities = 224/415 (53%), Positives = 305/415 (73%) Query: 2 TTRQPLYKSLYFQVIVAIAIGILLGHFYPQTGVALKPLGDGFIKLIKMVIAPIIFCTVVS 61 T + YK+LYFQV+V + +GIL GHF+P G +LKPLGDGF+KL+KM+IAP++FCT+VS Sbjct: 13 TKPKAFYKALYFQVVVGLTLGILAGHFWPDLGASLKPLGDGFVKLVKMMIAPVVFCTIVS 72 Query: 62 GIAGMQNMKSVGKTGGYALLYFEIVSTIALLIGLVVVNVVQPGNGMHIDVSTLDASKVAA 121 GI + + + +GKT ++ F ++ ALLIGL V +++PG GMH+ ++LD + A Sbjct: 73 GITSLNDTREIGKTLVKSMALFYALTVAALLIGLAAVMIIEPGVGMHVSAASLDPTVAAR 132 Query: 122 YVTAGKDQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFID 181 Y F+L++IP++ GAFA G++L VL+ SV+ GF L R+G G+PV+ I+ Sbjct: 133 YAKQAAPVGFTDFVLHIIPHSFFGAFAEGEVLPVLLISVLVGFGLTRVGKAGEPVVQGIE 192 Query: 182 RFAHVMFNIINMIMKLAPIGALGAMAFTIGAYGVGSLVQLGQLMICFYITCVLFVLVVLG 241 F+HV+F IMKLAPIGA GAMAFT+G YG+ S+ LG L++ FY+ C +F++VV+G Sbjct: 193 SFSHVLFAAFGFIMKLAPIGAFGAMAFTVGKYGIDSIGSLGLLILTFYVACGVFLMVVIG 252 Query: 242 AICRAHGFSVLKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYS 301 + R HGFS+ K++RY REELLIVLGTSSSE LPR+L K+E LG KK V GLV+P GYS Sbjct: 253 TLARLHGFSLWKVLRYFREELLIVLGTSSSEPVLPRVLQKLEALGCKKGVSGLVLPMGYS 312 Query: 302 FNLDGTSIYLTMAAVFIAQATDTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLS 361 FNLDGT+IYLT+A++FIAQA D H+ +L V+LL+SKGAAGVTGSGF+ L ATL+ Sbjct: 313 FNLDGTAIYLTLASLFIAQACDIHLSGGQIFAMLGVMLLTSKGAAGVTGSGFVALVATLT 372 Query: 362 AVGHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKELDEDQLQAEL 416 + LPVAG+AL++GIDRFMSEARALT+++ N VA++VV+ W D + LQ EL Sbjct: 373 VMPDLPVAGVALLVGIDRFMSEARALTSIISNCVASIVVSIWENACDREVLQREL 427 Lambda K H 0.326 0.142 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 595 Number of extensions: 30 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 457 Length adjustment: 33 Effective length of query: 411 Effective length of database: 424 Effective search space: 174264 Effective search space used: 174264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory