Align Fructose import permease protein FrcC (characterized)
to candidate AZOBR_RS27940 AZOBR_RS27940 ABC transporter permease
Query= SwissProt::Q9F9B1 (360 letters) >FitnessBrowser__azobra:AZOBR_RS27940 Length = 329 Score = 135 bits (341), Expect = 1e-36 Identities = 97/311 (31%), Positives = 157/311 (50%), Gaps = 14/311 (4%) Query: 51 PLIVLVLSLIAFGVILGGKFFSAFTMTLILQQVAIVGIVGAAQTLVILTAGIDLSVGAIM 110 P + L +LI G I+ F S + +L + A +GI+ T VI GIDLSVG++ Sbjct: 19 PFLALA-ALIVLGTIVNPVFLSPGNIGNVLTRTAFIGIIAVGATFVITAGGIDLSVGSLA 77 Query: 111 VLSS----VIMGQF--TFRYGFPPAL-SVICGLGVGALCGYINGTLVARMKLPPFIVTLG 163 +S V+M + G P L V+ LG+G + G +NG LV + ++ FIVTLG Sbjct: 78 AFASGVMIVVMNALVGSMGAGLPVILIGVLVALGLGLVAGLVNGLLVTKGRMEAFIVTLG 137 Query: 164 MWQIVLASNFLYSANETIRAQDISANASILQFFGQNFRIGNAVFTYGVVVMVLLVCLLWY 223 I S Y A+ +S N+ I + + G +Y ++ ++ + Sbjct: 138 TMGI-FRSLVTYIAD----GGTLSLNSEIRTIYRPVYYGGVFGISYPILAFAVVALIGAL 192 Query: 224 VLNRTAWGRYVYAVGDDPEAAKLAGVNVTRMLISIYTLSGLICALAGWALIGRIGSVSPT 283 ++ RT +GRY A+G + A+ + +NV R+ + + L G+ A+A + R+GS S T Sbjct: 193 IMYRTRFGRYCAAIGSSEDVARYSAINVDRVKLLAFVLQGICVAIAVVIYVPRLGSASAT 252 Query: 284 AGQFANIESITAVVIGGISLFGGRGSIMGMLFGALIVGVFSLGLRLMGTDPQWTYLLI-G 342 G +E+I AV+IGG L GG G I G + GA+++ + L L G + I G Sbjct: 253 TGLLWELEAIAAVIIGGTMLKGGYGRIWGTVVGAVMLTLIDNILNLTGAISVYLNGTIQG 312 Query: 343 LLIIIAVAIDQ 353 ++II+AV + + Sbjct: 313 VIIIVAVLLQR 323 Lambda K H 0.327 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 329 Length adjustment: 29 Effective length of query: 331 Effective length of database: 300 Effective search space: 99300 Effective search space used: 99300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory