Align ABC transporter substrate-binding protein (characterized, see rationale)
to candidate AZOBR_RS25580 AZOBR_RS25580 ABC transporter substrate-binding protein
Query= uniprot:A0A166QFS3 (424 letters) >FitnessBrowser__azobra:AZOBR_RS25580 Length = 427 Score = 425 bits (1092), Expect = e-123 Identities = 211/416 (50%), Positives = 280/416 (67%), Gaps = 2/416 (0%) Query: 6 SLLPAALLTLCAGLPSLSSAADLTISCGAVGAELQLCKEAVQAWSKQTGNNVEVVSTPNS 65 +LL A +LT + LP+ + A +T++C +G LC++ Q W++++GN V VS P Sbjct: 10 ALLLAGMLTAVSALPA--AGATVTLACSGLGISFDLCRDGAQEWARRSGNEVRFVSPPKG 67 Query: 66 ATERLSFYQQILSAQSSDIDIIQIDMVWPGMLAKHLLDLREVLPANATQGYFQAQVDNAT 125 A+E+L+ YQQ+L+A S DID+ QID+VWPG+L + +DL++ + + A ++ AT Sbjct: 68 ASEQLALYQQLLAAGSPDIDVFQIDVVWPGILGNYFIDLKDRAGPDTVGRHLPAMIEAAT 127 Query: 126 VNGRLVTMPWFTDSGLLYYRKDLLEKYNQQVPRTWEEMTATARNIQQAERTAGNPNAWGY 185 V GRLV MPWF D+G+LY RKDLLE + + VP+TWEE+ TA IQ+AER AG WGY Sbjct: 128 VKGRLVAMPWFADAGVLYARKDLLEAHGRPVPQTWEELQDTAALIQRAERAAGRDRMWGY 187 Query: 186 IFQGRAYEGLTCNALEWISSQPEGGLVNSRGDIVVNSQASRTALTLAKSWVGDISPRGVL 245 ++QGRAYEGLT NALEWI+S+ G +V G I +++ + AL +A+ WVG ISP GVL Sbjct: 188 VWQGRAYEGLTVNALEWIASRNGGTIVAPDGAITIDNPQAAEALAMARGWVGSISPPGVL 247 Query: 246 NYTEEEGRGVFQSGNALFMRNWPYVWALVQGQDSAVKDKVGVAPLPRGGETGTHASTLGG 305 NY EEE RGVFQSGNA+FMRNWPY W LV DSAV KV V PLP+GG G H STLGG Sbjct: 248 NYMEEEARGVFQSGNAVFMRNWPYAWTLVNAADSAVGGKVAVVPLPKGGPEGRHTSTLGG 307 Query: 306 WGLAVSRYSAHPKLAAELVSYLTSAQEQKHRALIGAYNPVIESLYQDPELLAAMPYYAQL 365 LAVS++SAH AA+L YLT EQK RA+ GA NP I +LY+D E++AA P++A L Sbjct: 308 QLLAVSKFSAHADEAADLALYLTGLAEQKRRAIHGASNPTIPALYEDAEVVAANPFFAAL 367 Query: 366 HSILNDGVMRPASITADRYPRVSNAFFDRVHGVLAGELPVDQALAELESELTRIKR 421 + + V RPA T RY +VS F+ VH VL+G L++L+ L RI R Sbjct: 368 AESIANAVNRPAQATGMRYNQVSAEFYANVHEVLSGRQDAKAMLSDLKEALVRISR 423 Lambda K H 0.316 0.131 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 476 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 427 Length adjustment: 32 Effective length of query: 392 Effective length of database: 395 Effective search space: 154840 Effective search space used: 154840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory