Align Maltose transport system permease protein malF aka TT_C1628, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)
to candidate AZOBR_RS00070 AZOBR_RS00070 glycerol-3-phosphate transporter permease
Query= TCDB::Q72H67 (291 letters) >FitnessBrowser__azobra:AZOBR_RS00070 Length = 294 Score = 129 bits (323), Expect = 1e-34 Identities = 87/283 (30%), Positives = 137/283 (48%), Gaps = 7/283 (2%) Query: 9 LAWILVLPTLLVVVLVAGYPLAQVFYWSFFKADIAFVEPPEFVGLENYAYLFQDPDFRQA 68 L ++L+ P + V ++ +P AQ + S D AF +FVGLEN+ + DP++ + Sbjct: 12 LPYLLLAPQVAVTLIFFIWPAAQALWQSVHLQD-AFGLRSQFVGLENFQAVLSDPNYLET 70 Query: 69 LWNTLKFTVVSVSLETVLGLAIALIIHSNFRGRGLVRTAILIPWAIPTVVSAKMWQWMLN 128 + T+ F+ L L +A++ S R +T ++ P+A+ V+A +W ++ N Sbjct: 71 VKTTIVFSASVTVLSLASALGLAVMADSKIRAASAYKTLLIWPYALAPAVAAVLWMFIFN 130 Query: 129 DVYGVINVLGVKLGLLSQKVAFLARPELLLPSIIAVDVWKTTPFMALLLLAGLQMIPEEL 188 G+ LG L L + L +I WK + + LAGLQ IP + Sbjct: 131 PDIGI---LGRALNNLGYAWDYRLNDGQALTMVILAASWKQVSYNFIFFLAGLQAIPRSV 187 Query: 189 YEAASIDGASRWQQFWSITLPLLTPALVVALIFRTLDA-LRVFDVVFVMS--GVNPATRT 245 EAASIDGA ++FW+IT PLL+P L+ + A F + ++ G AT T Sbjct: 188 LEAASIDGAGAVRRFWTITFPLLSPTTFFLLVVNIVYAFFETFGTIHALTHGGPGKATET 247 Query: 246 LAVYNRQTLVDFQDLGYGSAISVAILVIIFAFVLLYMRTVGKE 288 L Q V DLG SA SV ++VI+ A + R V ++ Sbjct: 248 LIFRVYQDGVVNHDLGGSSAQSVILMVIVIALTAIQFRFVERK 290 Lambda K H 0.329 0.142 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 294 Length adjustment: 26 Effective length of query: 265 Effective length of database: 268 Effective search space: 71020 Effective search space used: 71020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory