Align ABC transporter permease (characterized, see rationale)
to candidate AZOBR_RS18175 AZOBR_RS18175 sugar ABC transporter
Query= uniprot:A0A166QFV1 (320 letters) >FitnessBrowser__azobra:AZOBR_RS18175 Length = 295 Score = 177 bits (450), Expect = 2e-49 Identities = 96/288 (33%), Positives = 164/288 (56%), Gaps = 14/288 (4%) Query: 31 LFLTPMLLCLALVAAWPLLRTFWFSLTDANLADTGGGTFIGFGNYLFHNGSSWSGILVDP 90 LF+ P+ L L + +PL++ F S+T +L G T++G NY ++ DP Sbjct: 10 LFVAPVALYLLVFQGYPLVQEFLLSVTSTSLLSPGQQTYVGLDNY--------RELVFDP 61 Query: 91 QWWNAVRNTLYFTVVSVGLEVVLGLLVALLLNIKFTGRALVRALILIPWAIPTIVSAKIW 150 ++ +R T +T+V V + LGLL ALLL+ F GR + RAL+ IPWA P + +A I+ Sbjct: 62 EFHQVLRVTAVYTLVCVVASIGLGLLAALLLDGTFRGRGIARALVTIPWAAPPVAAALIF 121 Query: 151 SWMLNDQFGIINHLMLSLGLIDAPLAWTADADLSMWAVIIVDVWKTVPFVTLLMLAALQM 210 WM N Q+G+ +HL LG + + W + ++ A++I +W+ PF ++++LAALQ Sbjct: 122 VWMFNAQYGLFSHLAQFLGFAEGGVNWLDEPSFALPAILITTIWQIFPFSSVVILAALQG 181 Query: 211 LPSDCYEAARVDGIHPLKVFWRVTLPLLMPALLVAAIFRILDSLRVFDVIYVLTS----N 266 +PS+ EAA +DG L +F VT P + P++ + + + SLR FDVI+++T Sbjct: 182 VPSELREAAVIDGADRLSIFRAVTWPTIRPSVALLTLLITVWSLRRFDVIWLMTQGGPLG 241 Query: 267 SSSTMSMSVYARQHLVEFQDVGYGSAASTLLFLVVAVIALLYLYLGRR 314 ++T+ + +Y R + + D+G +A + +V ++ L+Y +L R Sbjct: 242 ETNTLVIDLYRRAFV--YLDLGRAAAVGIIGLVVAILVTLVYFWLSTR 287 Lambda K H 0.329 0.140 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 295 Length adjustment: 27 Effective length of query: 293 Effective length of database: 268 Effective search space: 78524 Effective search space used: 78524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory