Align LUD_dom domain-containing protein (characterized, see rationale)
to candidate AZOBR_RS01620 AZOBR_RS01620 putative oxidoreductase subunit with NAD(P)-binding domain and ferridoxin-like domain
Query= uniprot:Q726S4 (209 letters) >FitnessBrowser__azobra:AZOBR_RS01620 Length = 478 Score = 57.8 bits (138), Expect = 3e-13 Identities = 37/119 (31%), Positives = 56/119 (47%), Gaps = 12/119 (10%) Query: 94 IACVREGLRKHLAGIDIGFTHVTMGIAETGTCVVSSNSEELRLASMISEFHVAVLPKSKI 153 IA R+ LR+ D+G T + +AETG+ V+ +N L ++ HV + K+ Sbjct: 187 IAEARQVLRRKFQQADVGITGANIMVAETGSTVIVTNEGNGDLTQILPRVHVVIATIDKV 246 Query: 154 VATSYDAEATLNEL----MGTGKPHYTAFISGPSRTADIERVLSLGVHGPLELHLILVE 208 V T DA L L G YT F +GP R D++ GP E H++L++ Sbjct: 247 VPTLEDAALVLRLLARSATGQEASAYTTFSTGPRRPGDLD--------GPEEFHVVLLD 297 Lambda K H 0.317 0.132 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 209 Length of database: 478 Length adjustment: 27 Effective length of query: 182 Effective length of database: 451 Effective search space: 82082 Effective search space used: 82082 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory