GapMind for catabolism of small carbon sources

 

Alignments for a candidate for DVU3032 in Azospirillum brasilense Sp245

Align LUD_dom domain-containing protein (characterized, see rationale)
to candidate AZOBR_RS01625 AZOBR_RS01625 hypothetical protein

Query= uniprot:Q726S4
         (209 letters)



>FitnessBrowser__azobra:AZOBR_RS01625
          Length = 228

 Score = 72.8 bits (177), Expect = 5e-18
 Identities = 46/124 (37%), Positives = 65/124 (52%), Gaps = 7/124 (5%)

Query: 90  EERGIACVREGLRKHLAGIDIGFTHVTMGIAETGTCVVSSNSEELRLASMISEFHVAVLP 149
           ++R    V +G  +   G  +  T    G+AETGT ++ S +E     + + + H+ VL 
Sbjct: 106 DQRATLTVTKGRARDSDGASL--TGAFAGVAETGTLMLLSGAERPTTLNFLPDTHIVVLR 163

Query: 150 KSKIVATSYDAEATLNELMGT--GK---PHYTAFISGPSRTADIERVLSLGVHGPLELHL 204
           + +IV T  DA   L     T  GK   P    FI+GPSRT DIE  + LG HGP  LH+
Sbjct: 164 RGQIVGTMEDAWDRLRAAGATDGGKGALPRTVNFITGPSRTGDIEMRIELGAHGPRRLHI 223

Query: 205 ILVE 208
           +LVE
Sbjct: 224 LLVE 227


Lambda     K      H
   0.317    0.132    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 90
Number of extensions: 3
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 209
Length of database: 228
Length adjustment: 22
Effective length of query: 187
Effective length of database: 206
Effective search space:    38522
Effective search space used:    38522
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory