Align L-lactate dehydrogenase; L-LDH; EC 1.1.1.27 (characterized)
to candidate AZOBR_RS01310 AZOBR_RS01310 lactate dehydrogenase
Query= SwissProt::Q5SJA1 (310 letters) >FitnessBrowser__azobra:AZOBR_RS01310 Length = 313 Score = 377 bits (967), Expect = e-109 Identities = 199/304 (65%), Positives = 234/304 (76%) Query: 1 MKVGIVGSGMVGSATAYALALLGVAREVVLVDLDRKLAQAHAEDILHATPFAHPVWVRAG 60 MKVGIVG+G VG+ +A+ + G A EVVLVD++ KLA A A+DI HA PFA VR G Sbjct: 1 MKVGIVGAGAVGATAGFAMVMSGAASEVVLVDMNEKLAAAQAQDIAHAVPFARAAQVRHG 60 Query: 61 SYGDLEGARAVVLAAGVAQRPGETRLQLLDRNAQVFAQVVPRVLEAAPEAVLLVATNPVD 120 Y L GA VVLAAGVAQRPGETRLQLL+RNA VF ++P VL AAP+A+LLVATNP+D Sbjct: 61 GYAALAGAGVVVLAAGVAQRPGETRLQLLERNAAVFGAIIPAVLAAAPDAILLVATNPLD 120 Query: 121 VMTQVAYRLSGLPPGRVVGSGTILDTARFRALLAEYLRVAPQSVHAYVLGEHGDSEVLVW 180 VMTQ+A R+SGLPP RV+GSGTILDTARFRALLA+ L V P+SVHA+V+GEHGDSEVL+W Sbjct: 121 VMTQIATRISGLPPSRVIGSGTILDTARFRALLADRLGVTPKSVHAHVVGEHGDSEVLLW 180 Query: 181 SSAQVGGVPLLEFAEARGRALSPEDRARIDEGVRRAAYRIIEGKGATYYGIGAGLARLVR 240 S A V +P+ AE R L+ EDRA IDEGVRRAAY II+GKG T +GIG GL+R+V Sbjct: 181 SGATVACLPVDRGAERLKRPLTAEDRAAIDEGVRRAAYHIIDGKGHTAFGIGGGLSRIVA 240 Query: 241 AILTDEKGVYTVSAFTPEVEGVLEVSLSLPRILGAGGVEGTVYPSLSPEEREALRRSAEI 300 AI DE+ V T S EV GV +V+LSLPR++GAGGV TV P LS EE AL+RSAEI Sbjct: 241 AIAGDERAVLTCSILNDEVLGVPDVALSLPRVIGAGGVLETVMPDLSEEEAAALKRSAEI 300 Query: 301 LKEA 304 LKEA Sbjct: 301 LKEA 304 Lambda K H 0.319 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 313 Length adjustment: 27 Effective length of query: 283 Effective length of database: 286 Effective search space: 80938 Effective search space used: 80938 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate AZOBR_RS01310 AZOBR_RS01310 (lactate dehydrogenase)
to HMM TIGR01771 (L-lactate dehydrogenase (EC 1.1.1.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01771.hmm # target sequence database: /tmp/gapView.16248.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01771 [M=299] Accession: TIGR01771 Description: L-LDH-NAD: L-lactate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-106 341.6 0.0 2.3e-106 341.5 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS01310 AZOBR_RS01310 lactate dehydrogen Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS01310 AZOBR_RS01310 lactate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 341.5 0.0 2.3e-106 2.3e-106 1 299 [] 5 303 .. 5 303 .. 0.98 Alignments for each domain: == domain 1 score: 341.5 bits; conditional E-value: 2.3e-106 TIGR01771 1 iiGagaVGssvafalltqgladelvliDinedkaegealdlsdaasflkskvkvkagdyedlkdadlvv 69 i+GagaVG+++ fa++++g a+e+vl+D+ne+ a ++a d+++a++f+ + ++v++g y+ l++a +vv lcl|FitnessBrowser__azobra:AZOBR_RS01310 5 IVGAGAVGATAGFAMVMSGAASEVVLVDMNEKLAAAQAQDIAHAVPFA-RAAQVRHGGYAALAGAGVVV 72 8***********************************************.679***************** PP TIGR01771 70 itaGaeqkpgetRlelveknvkilksivkevvksgfdgillvvsNPvDiltyvvlklsglpkerviGsG 138 ++aG +q+pgetRl+l+e+n++++ i++ v ++++d+illv++NP+D++t++++++sglp++rviGsG lcl|FitnessBrowser__azobra:AZOBR_RS01310 73 LAAGVAQRPGETRLQLLERNAAVFGAIIPAVLAAAPDAILLVATNPLDVMTQIATRISGLPPSRVIGSG 141 ********************************************************************* PP TIGR01771 139 tvLdtaRlrrllaeklevdpksvhayvlGEHGdsevavwssakiagvplkelleekekekekelk.eie 206 t+LdtaR+r+lla++l+v pksvha+v+GEHGdsev +ws a++a +p+++ +e ++ +e++ +i+ lcl|FitnessBrowser__azobra:AZOBR_RS01310 142 TILDTARFRALLADRLGVTPKSVHAHVVGEHGDSEVLLWSGATVACLPVDRGAERLKRPLTAEDRaAID 210 ****************************************************99998885555555*** PP TIGR01771 207 kevrdaayeiiekKgaTsygiglavariveailkdekrvlpvsallegeygikdvylgvPavlgknGve 275 + vr+aay+ii+ Kg T +gig ++ riv ai de++vl++s+l ++ g+ dv+l++P+v+g+ Gv lcl|FitnessBrowser__azobra:AZOBR_RS01310 211 EGVRRAAYHIIDGKGHTAFGIGGGLSRIVAAIAGDERAVLTCSILNDEVLGVPDVALSLPRVIGAGGVL 279 ********************************************************************* PP TIGR01771 276 eilelkLseeEkeklkksaetlkk 299 e++ +LseeE ++lk+sae+lk+ lcl|FitnessBrowser__azobra:AZOBR_RS01310 280 ETVMPDLSEEEAAALKRSAEILKE 303 **********************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (299 nodes) Target sequences: 1 (313 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.35 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory