Align L-lactate dehydrogenase (cytochrome) (EC 1.1.2.3) (characterized)
to candidate AZOBR_RS19085 AZOBR_RS19085 glycolate oxidase
Query= BRENDA::W1QKE8 (558 letters) >FitnessBrowser__azobra:AZOBR_RS19085 Length = 362 Score = 195 bits (496), Expect = 2e-54 Identities = 126/363 (34%), Positives = 187/363 (51%), Gaps = 19/363 (5%) Query: 173 EVMNLHDFEYIAKKILPKGAWAYYSSGADDEVSMRENHYAYQRIYFRPRVLVDVSKVDTS 232 + ++L+D+E + AY + D ++ + N AY R+ PR L D+S + Sbjct: 6 DTVSLYDYERHFTARVDAATRAYIAGTGADGITRQANRDAYDRMRLMPRALRDLSGASAA 65 Query: 233 TTLLGTPTSVPFYVSATALAKLGHPDGECSIARGAGKEGVIQMISTLASNSLEEIAAARV 292 T+L G P ++ A +L H DGE + A+ AG G +ST +S +LEE+AAA Sbjct: 66 TSLFGQAMPYPILIAPMAFHRLVHRDGERATAQAAGLTGTWMTVSTQSSVTLEEVAAA-- 123 Query: 293 PGATQWFQLYVNEDRNVAFEMVKKAEKLGIKAIFVTVDAPSLGNREKDARVKFEGESDVQ 352 G WFQ+Y +V++AE G +A+ +TVDAP G R + R F + Sbjct: 124 AGGPLWFQIYTQPRPEDTLALVRRAEAAGYRALVLTVDAPVSGLRNIEQRAGFRLPDGIA 183 Query: 353 KSN-------EVVRSQGASRALSSFIDTRLTWDDVKKIKQSTKLPVLIKGVQRLEDVVQA 405 N ++ S + +WD V+ + T+LPVL+KG+ +DV A Sbjct: 184 PVNLAGLAPDSFTPTRPGSPVFQGMLHAAASWDTVRWLCAETRLPVLLKGIMNPDDVDLA 243 Query: 406 VDDGFDGVVLSNHGGRQLDTAPPPVELLAEVVPELKRRNKLRPDFEIFIDGGVRRGTDIL 465 V+ G G+++SNHGGR LDT P +AEV+P + R R I DGG+RRGTDIL Sbjct: 244 VEAGAAGIIVSNHGGRTLDTLP----AVAEVLPLVATRAAGR--LPILADGGIRRGTDIL 297 Query: 466 KALALGGQNVRVGVGLGRPFLYANSSYGENGVRKAIQLLKDELEMDMRLLGVRNLRELDE 525 KALALG V V G+P L+A + G GV + +L+ ELE+ M L G L ++D Sbjct: 298 KALALGADAVLV----GQPVLHALAVGGMAGVAHMLTILQTELEVAMALSGRARLADIDR 353 Query: 526 TFV 528 + + Sbjct: 354 SVI 356 Lambda K H 0.317 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 558 Length of database: 362 Length adjustment: 33 Effective length of query: 525 Effective length of database: 329 Effective search space: 172725 Effective search space used: 172725 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory