Align L-lactate dehydrogenase (cytochrome) (EC 1.1.2.3) (characterized)
to candidate AZOBR_RS27055 AZOBR_RS27055 L-lactate dehydrogenase
Query= reanno::WCS417:GFF3737 (376 letters) >FitnessBrowser__azobra:AZOBR_RS27055 Length = 384 Score = 241 bits (616), Expect = 2e-68 Identities = 136/369 (36%), Positives = 198/369 (53%), Gaps = 7/369 (1%) Query: 7 SDYRAAAKRKLPRFLFDYIDGGAYAEHTLRANSSDLAEISLRQRILRNVDNLSLKTTLFG 66 ++ R A+ +LPR LF+YID GA E + + + L + + R+L +V T LFG Sbjct: 10 AEARQRARARLPRGLFEYIDRGAEDETGIATSKTALDSLVFKPRVLVDVSKRDATTRLFG 69 Query: 67 QELDMPVILSPVGLTGMYARRGEVQAAKAAANKGIPFCLSTVSVCPIEEVASQSAQAIWF 126 + MP++++P + G+ GEV+ AKAAA GIPFC+ST S+ +E +A +S +WF Sbjct: 70 VDQPMPLVVAPTAVAGLVWYDGEVELAKAAAAVGIPFCVSTQSITSVERIAGESGARLWF 129 Query: 127 QLYVLKDRGFMRNALERAQAAGVTTLVFTVDMPTPGARYRDAHSGMSGPFAAQRRM-LQA 185 QLYV + R R + RA+ AG LV TVD R + +G P R L Sbjct: 130 QLYVWRSRERTRELVRRAERAGAEALVLTVDTAVTPNREYNVRNGFGIPIKPSVRAGLDC 189 Query: 186 VTKPQWAFDVGLMGRPHDLGNISKYLGKPTHLEDYIGWLANNFDASIS----WKDLEWIR 241 + P+W G+ + G + Y P +G +A + ++ W D+ +R Sbjct: 190 LAHPRWF--AGVFAKYLRNGGVPTYAHYPDEFRTALGRVAVGDEIGLAQDVGWGDVRSLR 247 Query: 242 EFWKGPMIIKGILDPQDAKDAVSFGADGIVVSNHGGRQLDGVLSTAKALPPIADAVGDDL 301 + WKG +I+KG+L DA+ A G DGIVVSNHG R LD + + L IA+ VGD + Sbjct: 248 DAWKGKLILKGVLRADDAEKAAELGVDGIVVSNHGARNLDHAIHPVRCLTDIAERVGDRV 307 Query: 302 TVLVDSGIRSGLDVVRMLALGAKACLLGRATAYALAADGQHGVENLLDIFAKEMRVAMTL 361 TVL DSG+R G V L LGA+ LLGRA Y LA DG G + +L++ +E+ M Sbjct: 308 TVLADSGVRRGSHVAGYLGLGAQGVLLGRAVLYGLATDGAAGAQAVLEMIRRELLTTMGF 367 Query: 362 TGVTSIAQI 370 G ++A I Sbjct: 368 LGAPTVADI 376 Lambda K H 0.321 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 384 Length adjustment: 30 Effective length of query: 346 Effective length of database: 354 Effective search space: 122484 Effective search space used: 122484 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory