Align acetate kinase (EC 2.7.2.1) (characterized)
to candidate AZOBR_RS04605 AZOBR_RS04605 acetate kinase
Query= BRENDA::Q9WYB1 (403 letters) >lcl|FitnessBrowser__azobra:AZOBR_RS04605 AZOBR_RS04605 acetate kinase Length = 398 Score = 261 bits (666), Expect = 3e-74 Identities = 164/405 (40%), Positives = 232/405 (57%), Gaps = 22/405 (5%) Query: 3 VLVINSGSSSIKYQLIEMEGEK--VLCKGIAERIGIEGSRLVHRVGDEKH-----VIERE 55 +LVIN+GSSSIK+QL + V +G E IG +V G + + E Sbjct: 5 ILVINAGSSSIKFQLFDAADGTLPVRLRGRIEGIGTAPRLIVQESGQDGSRDGGVTLPAE 64 Query: 56 LPDHEEALKLILNTLVDEKLGVIKDLKEIDAVGHRVVHGGERFKESVLVDEEVLKAIEEV 115 D L + +LG + AVGHRVVHGG + V VD+ V+ +E Sbjct: 65 SGDGVPGALAFLGAWLRGRLGGAMPV----AVGHRVVHGGPAYDSHVAVDDAVIGTLETY 120 Query: 116 SPLAPLHNPANLMGIKAAMKLLPGVPNVAVFDTAFHQTIPQKAYLYAIPYEYYEKYKIRR 175 PLAPLH P NL I+A KLLP V VA FDTAFH+ + A YAIP + + +RR Sbjct: 121 VPLAPLHQPNNLAPIRAIRKLLPDVLQVACFDTAFHRHHSEPADRYAIP-DALHREGVRR 179 Query: 176 YGFHGTSHRYVSKRAAEILGKKLEELKIITCHIGNGASVAAVKYGKCVDTSMGFTPLEGL 235 YGFHG S+ Y++ R + L + +++ H+G+GAS+ A++ G+ VD++MGFT L+GL Sbjct: 180 YGFHGLSYEYIAGRLPD-LAPGIAGGRVVVAHLGSGASMCAIQDGRSVDSTMGFTALDGL 238 Query: 236 VMGTRSGDLDPAIPFFIMEKEGISPQEMYDILNKKSGVYGLSKGFSSDMRDIEEAALKGD 295 MGTR G LDP + ++M+K G+ + + +L G+ GLS G S+D+RD+ + D Sbjct: 239 PMGTRPGQLDPGVVLYLMDK-GMDARAIERLLYHDCGLKGLS-GISNDVRDLLAST---D 293 Query: 296 EWCKLVLEIYDYRIAKYIGAYAAAMNGVDAIVFTAGVGENSPITREDVCSYLEFLGVKLD 355 KL L+ + YR + IGA AAAM G+D +VFTAG+GE +P R+ + +LGV LD Sbjct: 294 PRAKLALDCFVYRASLAIGALAAAMGGIDGLVFTAGIGERAPAIRKAIAERARWLGVDLD 353 Query: 356 KQKNEETIRGKEGIISTPDSRVKVLVVPTNEELMIARDTKEIVEK 400 + N I+TPDSRVK V+PT+EE MIA T+ I+ + Sbjct: 354 EAGNAANAL----CITTPDSRVKGWVIPTDEERMIALHTRAILRR 394 Lambda K H 0.318 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 398 Length adjustment: 31 Effective length of query: 372 Effective length of database: 367 Effective search space: 136524 Effective search space used: 136524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate AZOBR_RS04605 AZOBR_RS04605 (acetate kinase)
to HMM TIGR00016 (ackA: acetate kinase (EC 2.7.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00016.hmm # target sequence database: /tmp/gapView.21823.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00016 [M=405] Accession: TIGR00016 Description: ackA: acetate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-102 326.6 0.0 2e-101 325.6 0.0 1.4 1 lcl|FitnessBrowser__azobra:AZOBR_RS04605 AZOBR_RS04605 acetate kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS04605 AZOBR_RS04605 acetate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 325.6 0.0 2e-101 2e-101 4 399 .. 3 387 .. 1 392 [. 0.88 Alignments for each domain: == domain 1 score: 325.6 bits; conditional E-value: 2e-101 TIGR00016 4 kkilvlnaGssslkfalldaense.kvllsglverikleeariktvedgekkeee..klaiedheeavk 69 + ilv+naGsss+kf+l+da+++ v l+g +e i + i e+g++++++ ++ ++ +v lcl|FitnessBrowser__azobra:AZOBR_RS04605 3 ETILVINAGSSSIKFQLFDAADGTlPVRLRGRIEGIGTAPRLIV-QESGQDGSRDggVTLPAESGDGVP 70 689******************965145699******99988555.455554444411222344445666 PP TIGR00016 70 kllntlkkdkkilkelseialiGHRvvhGgekftesvivtdevlkkikdiselAPlHnpaelegieavl 138 l l + + + + ++GHRvvhGg + + v v+d v+ ++ ++lAPlH p++l i+a+ lcl|FitnessBrowser__azobra:AZOBR_RS04605 71 GALAFLGAWLRGRLGGAMPVAVGHRVVHGGPAYDSHVAVDDAVIGTLETYVPLAPLHQPNNLAPIRAIR 139 666666653333444455578************************************************ PP TIGR00016 139 klkvllkaknvavFDtafHqtipeeaylYalPyslykelgvRrYGfHGtshkyvtqraakllnkplddl 207 k l+++ +va+FDtafH+ e+a Ya+P ++ ++ gvRrYGfHG+s++y++ r+ +l ++ lcl|FitnessBrowser__azobra:AZOBR_RS04605 140 --KLLPDVLQVACFDTAFHRHHSEPADRYAIP-DALHREGVRRYGFHGLSYEYIAGRLPDLAP-GIAGG 204 ..8889999***********************.777788******************998655.59*** PP TIGR00016 208 nlivcHlGnGasvsavknGksidtsmGltPLeGlvmGtRsGdiDpaiisylaetlglsldeieetlnkk 276 +++v+HlG Gas++a+++G+s+d +mG+t L+Gl mGtR G++Dp+++ yl+++ g+ + +ie++l + lcl|FitnessBrowser__azobra:AZOBR_RS04605 205 RVVVAHLGSGASMCAIQDGRSVDSTMGFTALDGLPMGTRPGQLDPGVVLYLMDK-GMDARAIERLLYHD 272 ***************************************************985.999*********** PP TIGR00016 277 sGllgisglssDlRdildkkeegneeaklAlkvyvhRiakyigkyiaslegelDaivFtgGiGenaaev 345 Gl g+sg+s+D+Rd+l+ + + +aklAl+ +v+R ig+ +a++ g +D++vFt+GiGe a + lcl|FitnessBrowser__azobra:AZOBR_RS04605 273 CGLKGLSGISNDVRDLLAST---DPRAKLALDCFVYRASLAIGALAAAMGG-IDGLVFTAGIGERAPAI 337 *****************998...789***********************76.***************** PP TIGR00016 346 relvleklevlGlkldlelnnaarsgkesvisteeskvkvlviptneelviaeD 399 r+ + e+ + lG++ld++ n + i+t++s+vk vipt+ee +ia lcl|FitnessBrowser__azobra:AZOBR_RS04605 338 RKAIAERARWLGVDLDEAGNA----ANALCITTPDSRVKGWVIPTDEERMIALH 387 ****************99998....67789*********************965 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (405 nodes) Target sequences: 1 (398 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.06u 0.01s 00:00:00.06 Elapsed: 00:00:00.06 # Mc/sec: 2.62 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory