Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate AZOBR_RS32415 AZOBR_RS32415 branched-chain amino acid ABC transporter permease
Query= TCDB::P21627 (307 letters) >FitnessBrowser__azobra:AZOBR_RS32415 Length = 305 Score = 191 bits (485), Expect = 2e-53 Identities = 101/304 (33%), Positives = 177/304 (58%), Gaps = 21/304 (6%) Query: 7 YLQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLAMMGLD 66 +LQQ++NGL++G YAL+AIG+T+++G++ ++NFAHGEVY IG+++ + IT +A L Sbjct: 7 FLQQVINGLSIGCVYALMAIGFTLIFGVLNVVNFAHGEVYTIGAFVGLMVITAMAPPLLA 66 Query: 67 SVPLMMLAAFAASIIVTSAFGYSIERVAYRPLRG----------GNRLIPLISAIGMSIF 116 VPL++ V + G +ER+A+RP R R L+S++ +SI Sbjct: 67 VVPLVLA--------VGAVSGVGLERIAFRPFRRFTDEASQKSRAMREATLLSSLAVSIM 118 Query: 117 LQNAVMLSQDSKEKAIPTLLPGNFVFGESSMNGVVISYMQILIFVVTFLVMFGLTLFISR 176 + +M + IP+ G + ++ ++++ ++IF + +++ L + R Sbjct: 119 TREIMMHIFGGDMQGIPS---GYLLQQPVAIGPIMVASGSLVIFATSAVMLGALQFLLYR 175 Query: 177 SRLGRACRACAEDLKMTNLLGINSNNIIALTFVIGAALAAVAAVLLGMQYGVINPGIGFL 236 ++ G RA + + +GIN++ I TF +G+ L A A +L+G+ G I+P +GF Sbjct: 176 TQTGLGIRAVSNNQLGARYVGINTDRTIVTTFAVGSMLGATAGILVGLYDGAISPHMGFA 235 Query: 237 AGIKAFTAAVLGGIGSIPGAMLGGLLLGVAEAFGADVFGDQYKDVVAFGLLILVLLFRPT 296 G+KAF A V+GG+ SIPGA+ LLLGV+E+ + +KD++ + LL++ L+F P Sbjct: 236 PGVKAFVAMVMGGLSSIPGAVACALLLGVSESIATEFLSSGWKDLITYSLLVITLVFFPQ 295 Query: 297 GILG 300 G+ G Sbjct: 296 GLFG 299 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 305 Length adjustment: 27 Effective length of query: 280 Effective length of database: 278 Effective search space: 77840 Effective search space used: 77840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory