Align Aminomethyltransferase (EC 2.1.2.10) (characterized)
to candidate AZOBR_RS10470 AZOBR_RS10470 aminomethyltransferase
Query= reanno::pseudo6_N2E2:Pf6N2E2_5556 (374 letters) >lcl|FitnessBrowser__azobra:AZOBR_RS10470 AZOBR_RS10470 aminomethyltransferase Length = 370 Score = 429 bits (1103), Expect = e-125 Identities = 222/373 (59%), Positives = 268/373 (71%), Gaps = 6/373 (1%) Query: 2 STEQLLKTPLHALHLELGARMVPFAGYDMPVQYPLGVMKEHQHTRDQAGLFDVSHMGQIR 61 ++E L TPLH+LHLEL +MVPFAGYDMPVQYPLG++KEHQHTR +AGLFDVSHMGQ+R Sbjct: 4 ASESLKTTPLHSLHLELKGKMVPFAGYDMPVQYPLGILKEHQHTRAKAGLFDVSHMGQVR 63 Query: 62 LTGAGAAKALETLVPVDIIDLPVGMQRYAMFTNENGGILDDLMVANLGNDELFLVVNAAC 121 LTG A ALE+LVP DI L G RY +F NE GGILDDLMV N G D LFLVVNAA Sbjct: 64 LTGEDPAAALESLVPGDIKGLARGRMRYTLFLNEQGGILDDLMVTNAG-DHLFLVVNAAR 122 Query: 122 KDQDLAHLRAHIGAQCSIEPLFEARALLALQGPAAVTVLARLAPDVAKMTFMQFQRVTLL 181 KD D+AH+R + + +E L + AL+ALQGP A VL R P+ A M FM + T Sbjct: 123 KDHDVAHMRERLKGKAEVE-LLDDLALMALQGPEAAAVLGRFIPEAATMKFMSYLPTTFD 181 Query: 182 GMDCYVSRSGYTGEDGFEISVPAAEAEKLARALLAEPEVAAIGLGARDSLRLEAGLCLYG 241 G+ ++RSGYTGEDG+EIS ++AE +ARALLAE EV AIGLGARDSLRLEAGLCLYG Sbjct: 182 GIPVIITRSGYTGEDGYEISCDKSDAETIARALLAEDEVEAIGLGARDSLRLEAGLCLYG 241 Query: 242 HDMNTETTPIEASLLWAISKVRRADGARAGGFPGAETVFAQQQGGVKRKRVGLLPQERTP 301 HD++ TTP+E+ L WA+SK RR + GGFPG + Q G R+RVGL P+ R P Sbjct: 242 HDIDETTTPVESGLEWALSKRRREE----GGFPGYAIIKDQLANGAPRRRVGLQPEGRQP 297 Query: 302 VREGAEIVNEAGEIIGTVCSGGFGPTLGGPLAMGYLDSAYVALDTPVWAIVRGKKVPLLV 361 RE ++ + G+ IG V SGGFGPT P+AMGY+D A+ A+ TPV +VRGK + V Sbjct: 298 AREHTDVCDADGQKIGEVTSGGFGPTASAPVAMGYVDRAHAAVGTPVQLMVRGKPLAAKV 357 Query: 362 SKMPFVPQRYYRG 374 + MPFVPQRYYRG Sbjct: 358 AAMPFVPQRYYRG 370 Lambda K H 0.321 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 496 Number of extensions: 32 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 370 Length adjustment: 30 Effective length of query: 344 Effective length of database: 340 Effective search space: 116960 Effective search space used: 116960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate AZOBR_RS10470 AZOBR_RS10470 (aminomethyltransferase)
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.9893.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-112 359.6 0.0 9.8e-112 359.4 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS10470 AZOBR_RS10470 aminomethyltransfe Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS10470 AZOBR_RS10470 aminomethyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 359.4 0.0 9.8e-112 9.8e-112 1 361 [. 8 364 .. 8 365 .. 0.96 Alignments for each domain: == domain 1 score: 359.4 bits; conditional E-value: 9.8e-112 TIGR00528 1 lkrtpLydlhtelggklvdfaGwelPvqyk.slieeheavrtkaGlfDvshmgkvelsGskslkfLqrl 68 lk tpL+ lh el gk+v+faG+ +Pvqy ++ +eh+ +r kaGlfDvshmg+v+l+G++ ++L++l lcl|FitnessBrowser__azobra:AZOBR_RS10470 8 LKTTPLHSLHLELKGKMVPFAGYDMPVQYPlGILKEHQHTRAKAGLFDVSHMGQVRLTGEDPAAALESL 76 689**************************6489************************************ PP TIGR00528 69 lanDvdaLtkGkaqysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehleeevtldtl 137 ++ D++ L++G+ +y+ +ln qGG++DDl+v++ g+ + lvvnaa +++D ++++e+l+++++++ l lcl|FitnessBrowser__azobra:AZOBR_RS10470 77 VPGDIKGLARGRMRYTLFLNEQGGILDDLMVTNAGDH--LFLVVNAARKDHDVAHMRERLKGKAEVE-L 142 ***********************************99..99********************998875.6 PP TIGR00528 138 skeisllalqGPkaktiledlldkaveglkefffvqeaelalkkaliartGytGedGfeiavanekave 206 ++++l+alqGP+a+++l + +a +k + ++ + + + +i+r+GytGedG+ei++ + +a lcl|FitnessBrowser__azobra:AZOBR_RS10470 143 LDDLALMALQGPEAAAVLGRFIPEA-ATMKFMSYL-PTTFDGIPVIITRSGYTGEDGYEISCDKSDAET 209 799****************999765.568988888.889999999************************ PP TIGR00528 207 lwkklveaygvkPiGLgarDtLrleagmaLyGqeldeeitPleaglgwvvkker.kksdfiGravleeq 274 ++++l+++ v iGLgarD+Lrleag++LyG+++de++tP+e+gl+w+++k r ++ f G+a +++q lcl|FitnessBrowser__azobra:AZOBR_RS10470 210 IARALLAEDEVEAIGLGARDSLRLEAGLCLYGHDIDETTTPVESGLEWALSKRRrEEGGFPGYAIIKDQ 278 **************************************************998757889********** PP TIGR00528 275 kengtekklvGlemlekgiarnelkvlltngekevGivtsGtlsPtLgknialayvdkelekiGtklev 343 +ng+ +++vGl+ ++ ar++ +v ++g +++G vtsG + Pt +a++yvd+ + +Gt ++ lcl|FitnessBrowser__azobra:AZOBR_RS10470 279 LANGAPRRRVGLQPEGRQPAREHTDVCDADG-QKIGEVTSGGFGPTASAPVAMGYVDRAHAAVGTPVQL 346 *******************************.9************************************ PP TIGR00528 344 evrnklvkikvvkklfvr 361 vr+k + +kv+ ++fv+ lcl|FitnessBrowser__azobra:AZOBR_RS10470 347 MVRGKPLAAKVAAMPFVP 364 ****************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (370 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 6.65 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory