Align Hydroxyacylglutathione hydrolase cytoplasmic; Glyoxalase II; Glx II; EC 3.1.2.6 (characterized)
to candidate AZOBR_RS20450 AZOBR_RS20450 hydroxyacylglutathione hydrolase
Query= SwissProt::O24496 (258 letters) >lcl|FitnessBrowser__azobra:AZOBR_RS20450 AZOBR_RS20450 hydroxyacylglutathione hydrolase Length = 253 Score = 192 bits (487), Expect = 7e-54 Identities = 104/259 (40%), Positives = 145/259 (55%), Gaps = 9/259 (3%) Query: 1 MKIFHVPCLQDNYSYLIIDESTGDAAVVDPVDPEKVIASAEKHQAKIKFVLTTHHHWDHA 60 M I +P DNY YL+ D ++G VVDP D + V+A E+ + + THHH DH Sbjct: 1 MDIHLIPAFADNYIYLLRDPASGAVGVVDPGDAQPVLAELERRNWTLTHIFNTHHHNDHI 60 Query: 61 GGNEKIK-QLVPDIKVYGGSLDKVKGCTDAVDNGDKLTLGQDINILALHTPCHTKGHISY 119 GGN +K + D+ + ++ + G+ ++ G + P HT GHI++ Sbjct: 61 GGNHALKARYGADVIGPRADVARIPDMETCLGEGETISFGS-LAAQVFFVPGHTSGHIAF 119 Query: 120 YVNGKEGENPAVFTGDTLFVAGCGKFFEGTAEQMYQSLCVTLAALPKPTQVYCGHEYTVK 179 + E A+F GDTLF GCG+ FEGT QM+ SL V L LP T+VYCGHEYT+ Sbjct: 120 WFT----EAKALFCGDTLFALGCGRLFEGTPAQMWASL-VKLRGLPDDTRVYCGHEYTLS 174 Query: 180 NLEFALTVEPNNGKIQQKLAWARQQRQADLPTIPSTLEEELETNPFMRVDKPEIQEKLGC 239 N FA+TVEP+N ++ + A QR+ PTIPSTL E TNPF+R D PE+Q LG Sbjct: 175 NARFAVTVEPDNAALKARAADIAAQRERGEPTIPSTLGVEKATNPFLRADVPEVQSALGM 234 Query: 240 --KSPIDTMREVRNKKDQW 256 P+ E+R +KD++ Sbjct: 235 AGADPVAVFAEIRGRKDRF 253 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 253 Length adjustment: 24 Effective length of query: 234 Effective length of database: 229 Effective search space: 53586 Effective search space used: 53586 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
Align candidate AZOBR_RS20450 AZOBR_RS20450 (hydroxyacylglutathione hydrolase)
to HMM TIGR03413 (gloB: hydroxyacylglutathione hydrolase (EC 3.1.2.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03413.hmm # target sequence database: /tmp/gapView.32077.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03413 [M=248] Accession: TIGR03413 Description: GSH_gloB: hydroxyacylglutathione hydrolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-109 349.5 0.0 5.5e-109 349.3 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS20450 AZOBR_RS20450 hydroxyacylglutath Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS20450 AZOBR_RS20450 hydroxyacylglutathione hydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 349.3 0.0 5.5e-109 5.5e-109 1 248 [] 3 253 .] 3 253 .] 0.99 Alignments for each domain: == domain 1 score: 349.3 bits; conditional E-value: 5.5e-109 TIGR03413 1 iiaipalsdNyiwllkdeks.eavvvDpgeaepvlealeekglkleaillTHhHaDHvggvaellekfp 68 i+ ipa++dNyi+ll+d++s ++ vvDpg+a+pvl+ le+++++l++i++THhH+DH+gg+++l+++++ lcl|FitnessBrowser__azobra:AZOBR_RS20450 3 IHLIPAFADNYIYLLRDPASgAVGVVDPGDAQPVLAELERRNWTLTHIFNTHHHNDHIGGNHALKARYG 71 688*****************9999********************************************* PP TIGR03413 69 vkvvgpaee..ripgltkevkegdevellelevevlevpGHtlgHiayyleeekvlFcgDtLfsaGCGr 135 ++v+gp+++ rip +++ + eg+++++++l+++v+ vpGHt+gHia++++e+k+lFcgDtLf++GCGr lcl|FitnessBrowser__azobra:AZOBR_RS20450 72 ADVIGPRADvaRIPDMETCLGEGETISFGSLAAQVFFVPGHTSGHIAFWFTEAKALFCGDTLFALGCGR 140 *********99********************************************************** PP TIGR03413 136 lfegtaeqmleslqklaaLpeetkvycaHEYtlsNlrFalavepenealkerlkevealrakgkptlPs 204 lfegt++qm++sl kl+ Lp++t+vyc+HEYtlsN+rFa++vep+n+alk+r+++++a+r++g+pt+Ps lcl|FitnessBrowser__azobra:AZOBR_RS20450 141 LFEGTPAQMWASLVKLRGLPDDTRVYCGHEYTLSNARFAVTVEPDNAALKARAADIAAQRERGEPTIPS 209 ********************************************************************* PP TIGR03413 205 tlaeekatNpFLraeeaevkaaleeekaeevevfaelRekkdkf 248 tl+ ekatNpFLra+ +ev++al+++ a++v+vfae+R +kd+f lcl|FitnessBrowser__azobra:AZOBR_RS20450 210 TLGVEKATNPFLRADVPEVQSALGMAGADPVAVFAEIRGRKDRF 253 ******************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (253 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.28 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory