Align Serine hydroxymethyltransferase; SHMT; Serine methylase; EC 2.1.2.1; L-threonine/L-allo-threonine aldolase; EC 4.1.2.48 (uncharacterized)
to candidate AZOBR_RS10015 AZOBR_RS10015 serine hydroxymethyltransferase
Query= curated2:D3DKC4 (427 letters) >FitnessBrowser__azobra:AZOBR_RS10015 Length = 425 Score = 498 bits (1283), Expect = e-145 Identities = 255/417 (61%), Positives = 309/417 (74%), Gaps = 7/417 (1%) Query: 4 LFNTDAEIYEAIVKEYERQFYHLELIASENFTSLAVMEAQGSVMTNKYAEGLPHKRYYGG 63 L TD E+ A+ E RQ +ELIASEN S AV+EAQGSVMTNKYAEG P +RYYGG Sbjct: 9 LAETDPELARAVRDELVRQQEQIELIASENIVSQAVLEAQGSVMTNKYAEGYPGRRYYGG 68 Query: 64 CEFVDIAEDLAIERAKALFDAEHANVQPHSGTQANMAVYMAVLKPGDTIMGMDLSHGGHL 123 CE+VD+AE LAIERA LF ANVQP+SG+QAN AV +A+L+PGDTI+GM L+ GGHL Sbjct: 69 CEYVDVAETLAIERACKLFGCGFANVQPNSGSQANQAVNLALLQPGDTILGMSLAAGGHL 128 Query: 124 THGAKVNFSGKIYNAVYYGVHPETHLIDYDQLYRLAKEHKPKLIVGGASAYPRVIDWAKL 183 THGA N SGK + AV YGV + HLID+D++ RLA+EHKPKLI+ G SAYPRV+D+ + Sbjct: 129 THGAAPNLSGKWFKAVQYGVRRDDHLIDFDEVERLAREHKPKLIIAGGSAYPRVLDYQRF 188 Query: 184 REIADSVGAYLMVDMAHYAGLIAGGVYPNPVPYAHFVTSTTHKTLRGPRSGFILC-KKEF 242 R IAD VGAY MVD+AHYAGLIAGGVYPNP PYA VT+TTHKTLRGPR G +L +E Sbjct: 189 RAIADEVGAYFMVDIAHYAGLIAGGVYPNPFPYADVVTTTTHKTLRGPRGGMVLTNSEEI 248 Query: 243 AKDIDKSVFPGIQGGPLMHVIAAKAVAFKEAMSQEFKEYARQVVANARVLAEEFIKEGFK 302 AK I+ +VFPG+QGGPLMHVIAAKAVAF EA+ EFK YA+ V+ NAR L++ I+ G Sbjct: 249 AKKINSAVFPGLQGGPLMHVIAAKAVAFAEALRPEFKTYAKSVLDNARALSKVLIEGGLD 308 Query: 303 VVSGGTDSHIVLLDLRDTGLTGREVEEALGKANITVNKNAVPFDPLPPVKTSGIRLGTPA 362 +VSGGTDSHIVL+DLR LTG+ E +L A +T NKN VPFDP P+ TSG+RLG+PA Sbjct: 309 IVSGGTDSHIVLVDLRPKNLTGKAAEASLEHAGMTCNKNGVPFDPQKPMVTSGVRLGSPA 368 Query: 363 MTTRGMKEDQMRIIARLISKVI-----KNIGDEKVIE-YVRQEVIEMCEQFPLYPEL 413 TTRG + + RLI + + N GD +E VR+EV E+C +FP+YP L Sbjct: 369 ATTRGFGVAEFEQVGRLIVETLDGLAASNSGDNAAVEAKVREEVRELCRRFPIYPTL 425 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 615 Number of extensions: 28 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 425 Length adjustment: 32 Effective length of query: 395 Effective length of database: 393 Effective search space: 155235 Effective search space used: 155235 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory