Align L-threonine dehydrogenase (EC 1.1.1.103) (characterized)
to candidate AZOBR_RS32240 AZOBR_RS32240 acetaldehyde dehydrogenase
Query= ecocyc::EG12293-MONOMER (383 letters) >FitnessBrowser__azobra:AZOBR_RS32240 Length = 886 Score = 198 bits (504), Expect = 4e-55 Identities = 135/372 (36%), Positives = 192/372 (51%), Gaps = 39/372 (10%) Query: 30 GFTRTLIVTDNMLTKLGMAGDVQKALEERNIFSVIYDGTQPNPTTENVAAGLKLLKENNC 89 G R LIVTD L + G + + L+ + + +PT V GL L Sbjct: 476 GKKRCLIVTDRFLFENGHVDETVRILKGLGLAVETFFEVAADPTLAVVRRGLALANAFQP 535 Query: 90 DSVISLGGGSPHDCAKGIALVAANGGDI--------------RDYEGVDRSAKPQLPMIA 135 D +++LGGGSP D AK I V D+ R Y K Q +A Sbjct: 536 DVILALGGGSPMDAAK-IMWVMYEAPDVAFEDLALRFMDIRKRIYTFPKLGVKAQF--VA 592 Query: 136 INTTAGTASEMTRFCIITDEARHIKMAIVDKHVTPLLSVNDSSLMIGMPKSLTAATGMDA 195 + TT+GT SE+T F ++TDE IK I D +TP +++ D++L++ MPK LTAA G+DA Sbjct: 593 VPTTSGTGSEVTPFAVVTDERTGIKYPIADYELTPNMAIIDANLVMDMPKGLTAAGGIDA 652 Query: 196 LTHAIEAYVSIAATPITDACALKAVTMIAENLPLA-VEDGSNAKAREAMAYAQFLAGMAF 254 +THA+EAYVS+ A TD AL+A+ ++ E+LP A G + KARE + A LAG+AF Sbjct: 653 VTHALEAYVSVLANEYTDGQALQALKLLKEHLPSAYANGGKDPKAREQVHSAATLAGIAF 712 Query: 255 NNASLGYVHAMAHQLGGFYNLPHGVCNAVLLPHVQVFNS---------------KVAAAR 299 NA LG H+MAH+LG ++LPHGV NA+L+ +V +N+ AR Sbjct: 713 ANAFLGVCHSMAHKLGAEFHLPHGVANALLIANVIRYNAADIPTKQTAFSQYDRPKGVAR 772 Query: 300 LRDCAAAMGVNVTGKNDAEGAEACINAIRELAKKVDIPAGLRDLNVKEEDFA----VLAT 355 + A +G+ G D E E + + EL + +DIPA ++ V E +F +A Sbjct: 773 YAEIARHLGLG--GSRDHERVETLVAWVEELKRTLDIPASIQAAGVPEAEFLARLDAIAE 830 Query: 356 NALKDACGFTNP 367 A D C NP Sbjct: 831 AAFDDQCTGANP 842 Lambda K H 0.318 0.131 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 713 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 886 Length adjustment: 36 Effective length of query: 347 Effective length of database: 850 Effective search space: 294950 Effective search space used: 294950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory