Align Glyoxal reductase; GR; Methylglyoxal reductase; EC 1.1.1.-; EC 1.1.1.283 (characterized)
to candidate AZOBR_RS02275 AZOBR_RS02275 aldo-keto reductase
Query= SwissProt::O32210 (276 letters) >FitnessBrowser__azobra:AZOBR_RS02275 Length = 347 Score = 70.1 bits (170), Expect = 6e-17 Identities = 85/331 (25%), Positives = 126/331 (38%), Gaps = 83/331 (25%) Query: 14 GVEMPWFGLGVFKVENGNEATES---VKAAIKNGYRSIDTAAIY----------KNEEGV 60 G+ + GLG N E + A+ G DTA +Y + EE + Sbjct: 10 GLSVSAIGLGTMTWGRQNSEAEGHAQMDYALGEGVNFWDTAEMYAIPPTADTYGRTEEVI 69 Query: 61 GIGIKESGVAREELFITSKVWNEDQG-------------YETTLAAFEKSLERLQLDYLD 107 G K +G R+++ + SKV G AA E SL RLQ DY+D Sbjct: 70 GTWFKATG-KRDQVILASKVVGASDGGFAWVRNGEAKLDRANIFAAVEASLRRLQTDYID 128 Query: 108 LYLIHWP-------GKDKY-----------KDTWRALEKLYKDGKIRAIGVSNFQVHHLE 149 LY +HWP G Y ++T AL++L GK+R IGVSN + Sbjct: 129 LYQLHWPDRATNRFGARNYVHRPEKDGTPIEETLSALDELVTSGKVRHIGVSNESPWGVM 188 Query: 150 ELLKDAE------IKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPL----MQGQLLD 199 + LK AE I + N R ++ L + + + L A+SPL + G+ LD Sbjct: 189 QFLKLAEDKGLPRIASIQNAYNLLNRTFEQGLAEVSLREDVGLLAYSPLAAGTLTGKYLD 248 Query: 200 NEV--------------------------LTQIAEKHNKSVAQVILRWDLQHGVV--TIP 231 V +A +H S Q+ + + LQ V ++ Sbjct: 249 GAVPAGTRRALDHRKSRYATVNADVATREYLDVARRHGLSPTQMAIAFTLQQPFVASSLI 308 Query: 232 KSIKEHRIIENADIFDFELSQEDMDKIDALN 262 + + N D LS E M I+A+N Sbjct: 309 GATTMEDLKSNIAAVDVTLSDEVMKDIEAVN 339 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 347 Length adjustment: 27 Effective length of query: 249 Effective length of database: 320 Effective search space: 79680 Effective search space used: 79680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory