GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Azospirillum brasilense Sp245

Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate AZOBR_RS09720 AZOBR_RS09720 succinate-semialdehyde dehdyrogenase

Query= BRENDA::P51650
         (523 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS09720 AZOBR_RS09720
           succinate-semialdehyde dehdyrogenase
          Length = 497

 Score =  546 bits (1408), Expect = e-160
 Identities = 270/483 (55%), Positives = 362/483 (74%), Gaps = 7/483 (1%)

Query: 44  ADLLRGDSFVGGRWLPTPA--TFPVYDPASGAKLGTVADCGVPEARAAVRAAYDAFSSWK 101
           A+LLR   FV GRW+   +  T  V +PA G+ LG+V   G  E R A+ AA  A+ +W+
Sbjct: 17  AELLRFQGFVDGRWIDADSGKTVEVTNPADGSVLGSVPMMGADETRRAIEAAERAWPAWR 76

Query: 102 EISVKERSSLLRKWYDLMIQNKDELAKIITAESGKPLKEAQGEILYSAFFLEWFSEEARR 161
            ++ KER+  LR W+DLM+ N++++A+I+TAE GKPL EA+GE+ Y+A F+EWF+EE +R
Sbjct: 77  ALTAKERAKTLRTWFDLMMANQEDIARIMTAEQGKPLAEARGEVAYAASFIEWFAEEGKR 136

Query: 162 VYGDIIYTSAKDKRGLVLKQPVGVASIITPWNFPSAMITRKVGAALAAGCTVVVKPAEDT 221
           VYGD I      +R +V K+P+GV + ITPWNFP+AMITRK G ALAAGC +V+KPA  T
Sbjct: 137 VYGDTIPQHLPGRRIVVTKEPIGVTAAITPWNFPAAMITRKAGPALAAGCPMVIKPATAT 196

Query: 222 PYSALALAQLANQAGIPPGVYNVIPCSRTKAKEVGEVLCTDPLVSKISFTGSTATGKILL 281
           P +ALA+A LA +AGIP G+ +V+  S   A+ +G  +  +P V K++FTGST  GK L+
Sbjct: 197 PLTALAMAVLAERAGIPAGILSVVTGS---ARAIGGEMTGNPTVRKLTFTGSTEIGKELM 253

Query: 282 HHAANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNAGQTCVCSNRFLVQRGIH 341
              A +VK+VS+ELGG APF+VF+ A++D+AV GA+ASK+RN GQTCVC+NR LVQ G++
Sbjct: 254 AQCAGTVKKVSLELGGNAPFLVFNDADLDEAVKGAIASKYRNTGQTCVCANRLLVQSGVY 313

Query: 342 DSFVTKFAEAMKKSLRVGNGFE-EGTTQGPLINEKAVEKVEKHVNDAVAKGATVVTGGKR 400
           D+F  K AEA+K +L+VG G   EG  QGPLI+  AVEKVE H+ DA  KGA VV GGKR
Sbjct: 314 DAFAAKLAEAVK-ALKVGPGLTTEGAQQGPLIDMAAVEKVEDHIRDATEKGARVVLGGKR 372

Query: 401 HQSGGNFFEPTLLSNVTRDMLCITEETFGPVAPVIKFDKEEEAVAIANAADVGLAGYFYS 460
           H+ GG+FFEPT+L++VT  M    EETFGPVAP+ +F+ EEEAV +ANA + GLA YFYS
Sbjct: 373 HELGGSFFEPTILADVTPAMKVAREETFGPVAPLFRFETEEEAVRMANATEFGLAAYFYS 432

Query: 461 QDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEVKYVCY 520
           +D  ++WRVAE LE G+VG+NEG+IS+   PFGG+K+SG+GREGSKYGI++YLE+KY+C 
Sbjct: 433 RDIGRVWRVAEALEYGIVGINEGIISTEVAPFGGMKESGIGREGSKYGIEDYLEIKYLCM 492

Query: 521 GGL 523
           GG+
Sbjct: 493 GGI 495


Lambda     K      H
   0.318    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 676
Number of extensions: 20
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 523
Length of database: 497
Length adjustment: 34
Effective length of query: 489
Effective length of database: 463
Effective search space:   226407
Effective search space used:   226407
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory