GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoB in Azospirillum brasilense Sp245

Align phosphopentomutase (EC 5.4.2.7) (characterized)
to candidate AZOBR_RS33725 AZOBR_RS33725 phosphomannomutase

Query= BRENDA::Q6I7B6
         (450 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS33725 AZOBR_RS33725
           phosphomannomutase
          Length = 468

 Score =  167 bits (423), Expect = 7e-46
 Identities = 140/459 (30%), Positives = 211/459 (45%), Gaps = 38/459 (8%)

Query: 9   IRGTLWEKVTPELAMKVGMAVGTY---KSGK-ALVGRDGRTSSVMLKNAMISGLLSTGME 64
           IRG +   +T   A  VG A GT    K G  A +G DGR SS  L+ A++ GL+STG+ 
Sbjct: 17  IRGIVGTTLTTADARAVGRAFGTMIVRKGGTTACIGYDGRHSSPELEEALVDGLVSTGLR 76

Query: 65  VLDADLIPTPALAWGTR-KLADAGVMITASHNPPTDNGVKVFNGDGTEFYVEQERGLEEI 123
           V    L PTP L + TR + AD G+MIT SHNPP  NG+K+  G G   Y    + L  I
Sbjct: 77  VTRIGLGPTPMLYFATRDREADGGIMITGSHNPPEYNGIKMMLGKGP-VYGAMIQELGAI 135

Query: 124 IFSGNFRKARWDEIKPVRNVEVIPDYINAVLDFVGHETNLKVLYDGANGAGSLVAPYLLR 183
             +G++             V+V   Y+  +L       +LK+ +D  NGA   +   L  
Sbjct: 136 AAAGDYATGAGS----AERVDVQDAYVARLLKDYDGVRDLKIAWDAGNGATGEILRRLTA 191

Query: 184 EMGAKVLSVNAHVDGHFPGRKPEPRYE-NIAYLGKLVRELGVDLAIAQDGDADRIAVFDE 242
            +  + + +   +DG FP   P+P  E N+  L K V E G D+ I  DGD DRI   D 
Sbjct: 192 TLPGEHILLFDAIDGDFPNHHPDPTVEKNLVDLKKAVAEHGCDIGIGFDGDGDRIGAIDH 251

Query: 243 KGNYVDEDTVIALFAKLYVEEHGGGTVVVSIDTGSRIDAVVERAGGRVVRIPLGQPHDGI 302
            G  V  D ++A++A   ++ H G T++  +     +   + R GG+ +    G  H  +
Sbjct: 252 LGRVVWGDQLVAIYAADVLKSHPGATIIADVKASQTLFDEIARLGGQPLMWKTG--HSLL 309

Query: 303 KRYKA-------------IFAAEPWKLVHPKFGPWIDPFVTMGLLIKLIDENGPLSELVK 349
           K   A             IF A+ W      +G     +  + L+ ++    GPL+ L  
Sbjct: 310 KAKMAETGSPLAGEMSGHIFFADKW------YGFDDALYCAVRLIGQVSRSGGPLAALRD 363

Query: 350 EIP-TYYLKKANVLCPDEYKAEVVRRAAEEVERKLSSEIKEVLTISGFRIALNDGSWILI 408
            +P      +      +E K +VVR    EV+ +L +E  +V  I G R+   DG W L+
Sbjct: 364 RLPEVINTPETRFQADEERKFQVVR----EVKERLKAEGAQVNDIDGVRVQTPDG-WWLL 418

Query: 409 RPSGTEPKIRVVAEAPTEKRRDELFEMAYSTVSRIVKEA 447
           R S T+  +   AE+ T+   + L  M  + +     EA
Sbjct: 419 RASNTQDVLVARAESSTQDGLERLKSMVVAQLEASGLEA 457


Lambda     K      H
   0.318    0.138    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 537
Number of extensions: 28
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 450
Length of database: 468
Length adjustment: 33
Effective length of query: 417
Effective length of database: 435
Effective search space:   181395
Effective search space used:   181395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory