Align 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized)
to candidate AZOBR_RS29850 AZOBR_RS29850 ketohydroxyglutarate aldolase
Query= BRENDA::Q0K1X1 (214 letters) >FitnessBrowser__azobra:AZOBR_RS29850 Length = 211 Score = 198 bits (504), Expect = 5e-56 Identities = 103/207 (49%), Positives = 133/207 (64%), Gaps = 1/207 (0%) Query: 5 TSPLLQRLADVP-VIPVLEFHSVDEALHVSEALVTGGLPLLEITLRTPVALEAIKAVAAA 63 T P L+ P ++PVL D A+ ++EALV GGL LE+TLRTP AL +A+AA Sbjct: 2 THPRLEPSLSGPRIVPVLVLDEPDTAVALAEALVAGGLTTLEVTLRTPAALACAEAIAAR 61 Query: 64 LPQACVGAGTVLNVEQLHAVRDAGAQFAVSPGLTPALAEGAQGAGISLLPGVATASEAMA 123 +P A VG GT++ EQ RDAGA+F VSPGLT LAE A+ AG+ LPG+AT +EA+ Sbjct: 62 VPGALVGLGTLIRPEQFAQARDAGARFVVSPGLTDRLAEAAKTAGLPYLPGIATVAEALI 121 Query: 124 ALEAGFTFLKFFPAQAAGGVPMLKSLGGPLPQLRFCPTGGIDAALAPTYLALPNVVCVGG 183 A+E GF LKFFPA GG P L+ + +P++RFCPTGG+ A L+LPNV +GG Sbjct: 122 AMEHGFRELKFFPAMLNGGAPALRGMAPLMPEIRFCPTGGLKAEHVKEILSLPNVFALGG 181 Query: 184 SWVVPKDAVASGDWGRIRTLAEQARAL 210 +W+ P DAV W I LA +A AL Sbjct: 182 TWLTPADAVKERRWSEIERLAREASAL 208 Lambda K H 0.319 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 214 Length of database: 211 Length adjustment: 21 Effective length of query: 193 Effective length of database: 190 Effective search space: 36670 Effective search space used: 36670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory