GapMind for catabolism of small carbon sources

 

Aligments for a candidate for treEIIA in Azospirillum brasilense Sp245

Align D-trehalose PTS system, I, HPr, and IIA components (characterized)
to candidate AZOBR_RS30470 AZOBR_RS30470 phosphoenolpyruvate-protein phosphotransferase

Query= reanno::WCS417:GFF4500
         (838 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS30470 AZOBR_RS30470
           phosphoenolpyruvate-protein phosphotransferase
          Length = 590

 Score =  324 bits (830), Expect = 1e-92
 Identities = 213/588 (36%), Positives = 325/588 (55%), Gaps = 26/588 (4%)

Query: 261 PVATQSSATLLRGVCASPGSAFG--QVVQ---VTDPELVITEQGTGGATERAALTRGLLA 315
           P A Q  +  LRG+  SPG A G   VV+   +  PE  +T         R A   G   
Sbjct: 6   PAAGQGRS--LRGLGVSPGIAIGPAHVVESGAIRVPEYTLTADQVEAEAARFADACG--K 61

Query: 316 ANEALQVLQDKAA---GSAQAEI---FRAHQELLEDPTLLEHAHRLLGEGKSAAFAWNSA 369
           A   ++ L+ KA    GSA  EI     AH  ++ +  L     R + +    A A   A
Sbjct: 62  ARRQIRKLKAKALVLPGSASEEIGFLLDAHLAMVTNSRLTRGVERRIQQELVNAEAAVQA 121

Query: 370 TLATVT-LFQGLGNALIAERAADLADVGQRVLKLILGIQDSAWD-LPERAILIAEQLTPS 427
            +AT+   F  + ++ +A R AD+ +VG+R+++ ++  +  A+  L   A+++AE+LTP+
Sbjct: 122 EIATIAQTFASMEDSYLAGRIADVREVGRRLIRNLMRHEYQAFSMLNPGAVILAEELTPA 181

Query: 428 QTASLDTRKVLGFVTVAGGATSHVAILARALGLPAICGVPAQVLALANGKQVLLDADKGE 487
            TA LD R+V GF TV GGA  H AI+AR+LG+PA+ GV   +  L NG  V++D  +G 
Sbjct: 182 DTALLDPRRVAGFATVLGGAEGHTAIMARSLGIPAVLGVGGLLAGLKNGITVIVDGVQGR 241

Query: 488 LHLEPNLAEIEQLEAARKHQVLRHQRDVAQASLPATTRDGHHVEVTANVASLQEVEHALT 547
           + ++P    +E     R  +    ++      LPA TRD   V + AN+   ++++HAL 
Sbjct: 242 VIIDPTPEVLEDYRQRRAEREREREQLKGLRKLPAVTRDNTAVTLQANLELPRDLDHALE 301

Query: 548 LGGEGVGLLRSEFLYLDRNRAPSPEEQAGTYTAIARALGTERNLVVRTLDVGGDKPLAYV 607
            G +G+GLLR+EFL+++R++ P  +EQ     +I   +G  R +  RT+DVGG+K   ++
Sbjct: 302 NGAQGIGLLRTEFLFMNRDQLPDEDEQYTVLRSIVEGMG-GRTVTARTMDVGGEKLAGWM 360

Query: 608 P--MDAETNPFLGLRGIRLCLERPQLLREQFRAILASAGFARLHIMLPMVSLLSELHLAR 665
                   NP LGLR +RL L  P+LL  Q  A+L +     L I+LPM+  ++E+   R
Sbjct: 361 AGRYGEPANPALGLRAVRLGLREPKLLETQLAAMLRAGVHGPLRILLPMICSVAEVQRVR 420

Query: 666 KILEEEALALG------LTELPKLGIMIEVPSAALMADVFAPHVDFFSIGTNDLTQYTLA 719
           +++ + A  L          LP +G+M+EVP AAL AD  A   DFFSIGTNDLTQYTLA
Sbjct: 421 EMMGQVARRLRRRGVPIADPLPPVGVMVEVPGAALSADALAYAADFFSIGTNDLTQYTLA 480

Query: 720 MDRDHPRLANQADSFHPAVLRLIATTVKAAHAHGKWVGVCGALASEALAVPVLIGLGVDE 779
           +DR   ++A+  D  HPAVLRLI  T++AA      V VCG +A ++    +L+GLGV +
Sbjct: 481 IDRGDEQVASLYDPLHPAVLRLIQFTIEAALRARIPVSVCGEIAGDSRYTALLLGLGVRD 540

Query: 780 LSVSVPLIPTIKATVRELDLADCQIIARQVLGLEEAAEVREALRQYHA 827
           LS+  P IP +K  +R+LDL +    AR ++   ++  +   L  ++A
Sbjct: 541 LSMVPPAIPLVKRRIRKLDLQEATRRARVIMDQSDSGRIAALLDDFNA 588


Lambda     K      H
   0.318    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1011
Number of extensions: 42
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 838
Length of database: 590
Length adjustment: 39
Effective length of query: 799
Effective length of database: 551
Effective search space:   440249
Effective search space used:   440249
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory