Align α,α-trehalase / α-glucosidase (TTC0107) (EC 3.2.1.20|3.2.1.28) (characterized)
to candidate AZOBR_RS09450 AZOBR_RS09450 alpha-amylase
Query= CAZy::AAS80455.1 (528 letters) >FitnessBrowser__azobra:AZOBR_RS09450 Length = 1107 Score = 247 bits (631), Expect = 1e-69 Identities = 181/555 (32%), Positives = 264/555 (47%), Gaps = 113/555 (20%) Query: 1 MWWKEAVIYQVYPRSFQDTNGDGVGDLEGVRRRLPYLKSLGVDALWLSPFYKSPMKDFGY 60 +W+K+AVIYQ++ ++F D + DG+GD+ G+ ++L Y++ LGV LWL PFY SP++D GY Sbjct: 15 LWYKDAVIYQLHVKAFFDADNDGIGDIAGLTQKLDYIQELGVTTLWLLPFYPSPLRDDGY 74 Query: 61 DVADYCDVDPVFGTLQDFDRLLEEAHALGLKVLVDLVPNHTSSEHPWFLESR-ASRNSPK 119 D+ADY V+P +G LQDF R L E H GL+V+ +LV NHTS +HPWF +R A S Sbjct: 75 DIADYKAVNPSYGNLQDFKRFLRECHDRGLRVITELVINHTSDQHPWFQRARQAKPGSNH 134 Query: 120 RDWYIWKDPAPDGGPPNNWQSFFGGPAWTLDEATGQYYLHQFLPEQPDLNWRNPEVREAI 179 R++Y+W D WT D Y+ H+F QPDLN+ NP+V + + Sbjct: 135 RNFYVWSDTDQKYQGTRIIFCDTEKSNWTWDSEAQAYFWHRFYSHQPDLNFDNPKVLQEV 194 Query: 180 YEVMRFWLRRGVDGFRVDVLWLLAEDLLFRDEPGNPDWRPGMWDRGRHLHIFTEDQPETY 239 VMRFWL GVDG R+D + L E R+ N E+ PET+ Sbjct: 195 LNVMRFWLDMGVDGLRLDAVPYLKE----REGTNN------------------ENLPETH 232 Query: 240 AYVREMRQVLDEFSEPGRERVMVGEI------YLPYPQLVRYYQAGCHLPFNFHLIFR-- 291 ++ +R +D + +R+++ E LPY + CH+ F+F L+ R Sbjct: 233 DVLKAIRTEID---KGYGDRMLLAEANQWPEDVLPYFGDLEKGGDECHMAFHFPLMPRIY 289 Query: 292 ---GLPDWRPENLARIVEEYESLLTRWDWPNWVLGNHDQ--------------------- 327 + D P +A I+ + + W + L NHD+ Sbjct: 290 MAVAMEDRHP--IADIMRQTPDIPDECQWAIF-LRNHDELTLEMVTDRERDYLWDFYAAD 346 Query: 328 ----------PRLASRLGEAQARVAAM--LLFTLRGTPTWYYGDEIGMKNGEIPPEKVQD 375 RLA L + ++ + LL ++ GTP YYGDEIGM Sbjct: 347 RRMRINLGIRRRLAPLLQNDRRKIELLKSLLLSMPGTPVLYYGDEIGM------------ 394 Query: 376 PAALRQKDRLGEHNLPPGRDPERTPMQWDDTPFAGFSTVEP---WLPVNPD----YKTRN 428 G++ RD RTPMQW GFS +P +LP D ++ N Sbjct: 395 ----------GDNIYLGDRDGVRTPMQWSPDRNGGFSRADPARLYLPAIQDPIYGFQAIN 444 Query: 429 VAAQEQDPRSMLHLVRRLIALRKDPDLLYGAYR---TYRAREGVYAYLR-------GEGW 478 V AQ++ P S+L+ ++RLIA+R+ +G R Y V AYLR E Sbjct: 445 VEAQQRSPSSLLNWMKRLIAVRQQ-HKAFGRGRFQLLYPGNRKVLAYLRCHSTEEGDEVI 503 Query: 479 LVALNLTEKEKALEL 493 L NL+ +A+EL Sbjct: 504 LCVANLSRSAQAVEL 518 Lambda K H 0.321 0.141 0.466 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1863 Number of extensions: 109 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 528 Length of database: 1107 Length adjustment: 40 Effective length of query: 488 Effective length of database: 1067 Effective search space: 520696 Effective search space used: 520696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory