Align TreT, component of Trehalose porter (characterized)
to candidate AZOBR_RS25585 AZOBR_RS25585 ABC transporter permease
Query= TCDB::Q97ZC2 (275 letters) >FitnessBrowser__azobra:AZOBR_RS25585 Length = 301 Score = 125 bits (313), Expect = 1e-33 Identities = 86/283 (30%), Positives = 143/283 (50%), Gaps = 13/283 (4%) Query: 1 MNKVKLTFFLLVLPALAYVISFAFFPTIEAVYLSFQDP-------HGGFSLYNYKELSYF 53 M + + +L +LP L + A +P V+ SF D G L NY L Sbjct: 11 MRQRRRAAWLFLLPMLIVLAGVAGWPLFRTVFFSFTDATLATLEGFQGVGLDNYLWLMRD 70 Query: 54 NLS-SAIINTIVVTIGALAIQLALGFLVASVLSREFFGKRALSTITIIPMGIATVVAAVT 112 + A+ NT+V T+ ++ I+ ALG +A +L+ G+ L +IP I TVV+A Sbjct: 71 PVWWRAVWNTLVFTVVSVGIETALGLGIALILNAHLPGRGLLRAAVLIPWAIPTVVSAQM 130 Query: 113 FSFVFQTSGGYANTILHSLFGLNVN---WYQSSISSLLVVMIADSWKNTPIVALILLAGM 169 + ++F G N IL L GL W +L VV+ D WK+TP +AL++LA + Sbjct: 131 WGWMFHDLYGVVNAILMGL-GLIAEPRAWTADPDLALPVVIAVDVWKSTPFMALLILAAL 189 Query: 170 SSIPKELYYASAIDGAGPIRRFFYITLPNLRSFIGISLILRGVQEFNIFALPLILIGEHP 229 +P++LY A+ +DG P++ F ITLP +R + ++++ R + +F L +L G Sbjct: 190 QMLPRDLYEAARVDGVHPVKVFVRITLPLIRPALMVAVLFRTLDALRVFDLMYVLTGNSR 249 Query: 230 PLLTTLIY-DLYTTTFPEVGLALASATILLGFILVFSGIVIKL 271 ++ +Y Y F +VG A+AT+L+ + V + + + L Sbjct: 250 STMSMSVYARQYLIDFQDVGYGSAAATLLVLVLAVATVLAVTL 292 Lambda K H 0.328 0.143 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 301 Length adjustment: 26 Effective length of query: 249 Effective length of database: 275 Effective search space: 68475 Effective search space used: 68475 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory