Align arylformamidase (EC 3.5.1.9) (characterized)
to candidate AZOBR_RS04120 AZOBR_RS04120 hypothetical protein
Query= metacyc::MONOMER-19505 (304 letters) >FitnessBrowser__azobra:AZOBR_RS04120 Length = 271 Score = 152 bits (385), Expect = 6e-42 Identities = 99/277 (35%), Positives = 141/277 (50%), Gaps = 10/277 (3%) Query: 10 MDRATLDRQYSPSTTVPSLQAYLDDYRRISADARRRHPVRAGLAYGPHPAELLDYFPATG 69 M A +DRQY+ VP AY ++ S R R R + GPHP + D FPA Sbjct: 1 MTAAEIDRQYNFRKLVPEHPAYFARWQAESEAVRARLNGRYDVPTGPHPRQRADVFPAG- 59 Query: 70 RSDAPLLVFVHGGNWQALGRAESAFAVPALLAAGAAVAVVEYGLAPDTPLEAMAGMVRRS 129 AP+LVF+HGG W+AL + +F + G AV ++ YGL + ++ + G + Sbjct: 60 -EGAPVLVFIHGGYWRALSKDLHSFIAAPYVERGVAVVLLGYGLCSEVTMDELCGHAQAG 118 Query: 130 VAWLLRHADALGFAPDRLHLCGTSAGAHLAAMALLPHPDDGPDTSGRIAGAVLLSGIYDL 189 + W++ +A G P R+ + G SAG HL A + + D R+AG + +SG+YDL Sbjct: 119 LDWVIANAAGFGGDPRRVVVSGHSAGGHLTAKLVSENRD-------RVAGGIPISGLYDL 171 Query: 190 EPVQLSYVNDALRLDGAGARRNSPLLRLPPRLPPLVVARGDNETEEYVRQHEQMVAALRA 249 EP+ VN+ LRLD ARR SP+ +P P L+ A G ET+ RQ A A Sbjct: 172 EPMLGFEVNEQLRLDPDSARRLSPIHAVPTPAPLLMPALGGLETDAMHRQQADYALAWAA 231 Query: 250 RA-AVTEVVAERRDHFDLPYDLGVRGTGLGDAVLAQL 285 + AV E+V DHF + G+ L +A LA L Sbjct: 232 QGNAVREIVEPGADHFSVVDRFAEPGSLLFEAALAML 268 Lambda K H 0.319 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 271 Length adjustment: 26 Effective length of query: 278 Effective length of database: 245 Effective search space: 68110 Effective search space used: 68110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory