Align 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial; 3-hydroxyisobutyryl-coenzyme A hydrolase; HIB-CoA hydrolase; HIBYL-CoA-H; EC 3.1.2.4 (characterized)
to candidate AZOBR_RS08460 AZOBR_RS08460 enoyl-CoA hydratase
Query= SwissProt::Q5XIE6 (385 letters) >FitnessBrowser__azobra:AZOBR_RS08460 Length = 358 Score = 316 bits (809), Expect = 7e-91 Identities = 173/357 (48%), Positives = 224/357 (62%), Gaps = 16/357 (4%) Query: 35 AEVLLERRGCAGVITLNRPKLLNALSLNMIRQIYPQLKKWERDPDTFLIIIKGAGGKAFC 94 AE+L ERRG G++TLNRPK LNAL+L MIR PQL+ W DP+ I+++GAG KAFC Sbjct: 10 AEILFERRGSIGLVTLNRPKALNALTLGMIRLFDPQLRAWIADPEVKAIVVQGAGEKAFC 69 Query: 95 AGGDIKALSEAKKAGQTLSQD------LFREEYILNNAIASCQKPYVALIDGITMGGGVG 148 AGGD+ L E KA + D F EEY+LN I +C KPYVALIDGI+MGGGVG Sbjct: 70 AGGDVVNLYETGKAAKAGQDDGASIRAFFSEEYVLNRLIHTCPKPYVALIDGISMGGGVG 129 Query: 149 LSVHGQFRVATERSLFAMPETGIGLFPDVGGGYFLPRLQGKLGYFLALTGFRLKGRDVHR 208 LSVHG R+ TER++FAMPETGIGL+PDVGG YFLPRL G++G +L LTG RLK D+ Sbjct: 130 LSVHGSHRIVTERTMFAMPETGIGLYPDVGGTYFLPRLPGQVGIWLGLTGDRLKAADMIE 189 Query: 209 AGIATHFVDSEKLHVLEEELLALKSPSAEDVAGVLESYHAKSKMGQDKSIIFEEHMDKIN 268 G A FV S KL L E LA P+ E VA + + G+ +D+ Sbjct: 190 VGAADAFVPSAKLESLIAE-LADGVPADEAVA------RHREEAGEPPVAANRAAIDR-- 240 Query: 269 SCFSANTVEQILENLRQDGSPFAMEQIKVINKMSPTSLKITLRQLMEGSTKTLQEVLTME 328 C++ N VE I+ L +G+ +A Q+ + ++SPTSLK+TL L G+ + E Sbjct: 241 -CYAHNEVEAIVAALEAEGTEWAAGQLATLKRVSPTSLKVTLEALRRGAKLDFDGCMIQE 299 Query: 329 YRLTQACMEGHDFHEGVRAVLIDKDQTPKWKPADLKDVTDEDLNSYFKSLGSRDLKF 385 RL+ A + HD +EG+RA L+DKD+ P+W PA L DVT E++ YF DL+F Sbjct: 300 LRLSLAFLARHDVYEGIRAALVDKDRNPRWSPASLADVTAEEVAGYFAEPVGGDLRF 356 Lambda K H 0.320 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 358 Length adjustment: 30 Effective length of query: 355 Effective length of database: 328 Effective search space: 116440 Effective search space used: 116440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory