Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate AZOBR_RS18155 AZOBR_RS18155 enoyl-CoA hydratase
Query= reanno::Cup4G11:RR42_RS28545 (384 letters) >FitnessBrowser__azobra:AZOBR_RS18155 Length = 248 Score = 94.0 bits (232), Expect = 4e-24 Identities = 66/188 (35%), Positives = 96/188 (51%), Gaps = 7/188 (3%) Query: 31 IGLITLNRPRQLNALSYPMIGLLDAQLAAWAARDDIAAVVLRGAGPKAFCAGGDIRALYD 90 + ITL+RP++LNA++ M L A +A A DDI VVL GAGP+AFC G DIR L Sbjct: 5 VATITLDRPQKLNAVTPEMAAQLVAAVARCNADDDIRCVVLTGAGPRAFCCGSDIRELDR 64 Query: 91 SFHAGTALHRQFFVDEYQLDYRLHCYPKPVVALMDGIVMGGGMGLAQAAHLRVLTERSRV 150 A +R+ + D + KP +A ++G GGG+ A + +R+ +E ++ Sbjct: 65 YDTAWNFRNREDYCD------AIRGLRKPSIAAVNGYAFGGGLETAMSCDIRIASENAQF 118 Query: 151 AMPETGIGLVPDVGASHFLS-KLPLALALYVGLTGVTLGAADTLLCKLADIAVPAASLEH 209 PE +G + G + FLS + + A + LTG + A L L VPA L Sbjct: 119 GAPEIKLGWIGGGGVAAFLSHSIGTSNAAMMILTGDPIPADKALAWGLVSEVVPADRLLA 178 Query: 210 FEQTLAAI 217 Q +AAI Sbjct: 179 RAQEIAAI 186 Lambda K H 0.322 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 248 Length adjustment: 27 Effective length of query: 357 Effective length of database: 221 Effective search space: 78897 Effective search space used: 78897 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory