Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate AZOBR_RS32410 AZOBR_RS32410 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8DQH9 (318 letters) >FitnessBrowser__azobra:AZOBR_RS32410 Length = 355 Score = 166 bits (420), Expect = 8e-46 Identities = 106/300 (35%), Positives = 161/300 (53%), Gaps = 15/300 (5%) Query: 11 WLLLLLA-GYSLISVLVSVGVLNLFYVQILQQIGINIILAVGLNLIVGFSGQFSLGHAGF 69 W LLLLA + + + VG + + QI I +IL+ LN + G +G S+GHA F Sbjct: 30 WTLLLLAVAFGAVPAAI-VGTGSSYLAQIAITTMIFVILSASLNHVTGTAGLLSIGHAAF 88 Query: 70 MAIGAYAAAIIGSKSPTYGAFFGAMLVGALLSGAVALLVGIPTLRLKGDYLAVATLGVSE 129 IGAYAAA++ +K F + L++ LV +PT+RL Y AVATLG+ E Sbjct: 89 YGIGAYAAALLSTKLGL--PFIVTLPAAGLIAALFGFLVALPTMRLVSIYFAVATLGIGE 146 Query: 130 IIRIFIINGGSLTNGAAGILGIPNFTT--WQMV-----YFFVVITTIATLNFLR----SP 178 +I + ++N +T G GI GIP WQ Y V + +A + L S Sbjct: 147 MIYVVLLNWVDVTRGPMGIRGIPPIELFGWQADTLLTRYLAVAVIAVACVWVLHRLTHSY 206 Query: 179 IGRSTLSVREDEIAAESVGVNTTKIKIIAFVFGAITASIAGSLQAGFIGSVVPKDYTFIN 238 G + ++RED+ A+S+G+N ++KI +FV A IAG+L A + P ++ F+ Sbjct: 207 YGNALRALREDDQCADSMGINVERLKIESFVVATFFAGIAGALLAHTSAYIAPDNFRFME 266 Query: 239 SINVLIIVVFGGLGSITGAIVSAIVLGILNMLLQDVASVRMIIYALALVLVMIFRPGGLL 298 SI +L +VV GGLGS+ GA+V A+ + +L L+D+ RMI + L ++ P G+L Sbjct: 267 SILILAMVVVGGLGSLPGAVVGALFMIVLPEALRDIGDYRMIAVGATMFLSILLLPKGML 326 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 355 Length adjustment: 28 Effective length of query: 290 Effective length of database: 327 Effective search space: 94830 Effective search space used: 94830 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory