Align Malonate-semialdehyde dehydrogenase 1; MSA dehydrogenase 1; EC 1.2.1.-; Methylmalonate-semialdehyde dehydrogenase 1; MMSA dehydrogenase 1; MSDH 1; EC 1.2.1.27 (uncharacterized)
to candidate AZOBR_RS29185 AZOBR_RS29185 aldehyde dehydrogenase
Query= curated2:Q81QR5 (486 letters) >FitnessBrowser__azobra:AZOBR_RS29185 Length = 478 Score = 253 bits (647), Expect = 8e-72 Identities = 166/472 (35%), Positives = 237/472 (50%), Gaps = 10/472 (2%) Query: 10 KNHINGEWVESTGTEVEAVPNPAT-GKIIAYVPLSPKEDVEKAVEAAKAAYETWSKVPVP 68 +N I G V+ G +EA NPA G++I + + E E+A+ AA AA W+ Sbjct: 5 RNWIAGRLVD--GVRMEANRNPARPGEVIGHYAWASVEQAEEALGAAHAALPGWAASNPQ 62 Query: 69 NRSRQLYKYLQLLQENKEELAKIITLENGKTLTDATGEVQRGIEAVELATSAPNLMMGQA 128 RS L + L EEL ++T E GKTL + GEV+R + A P G+A Sbjct: 63 TRSDVLRRVGDELNARAEELGALLTREEGKTLREGIGEVRRSAQIFHYAAGEPLRQGGEA 122 Query: 129 LPNIASGIDGSIWRYPIGVVAGITPFNFPMMIPLWMFPLAIACGNTFVLKTSERTPLLAE 188 LP + G + R P+GVV ITP+NFPM +P W A+A GNT VLK SE TP A Sbjct: 123 LPGLRDGTTAMVSREPVGVVVLITPWNFPMAVPAWKTAYALAFGNTVVLKPSEVTPACAW 182 Query: 189 RLVELFYEAGFPKGVLNLVQG-GKDVVNSILENKDIQAVSFVGSEPVARYVYETGTKHGK 247 L ++ + AG P G NLV G G+ + ++++ D AVSF GS V R + E Sbjct: 183 ELADILHRAGLPAGAFNLVVGDGRTLGPALVDGAD--AVSFTGSPGVGRAILERSVARMT 240 Query: 248 RVQALAGAKNHAIVMPDCNLEKTVQGVIGSAFASSGERCMACSVVAVVDEIADEFIDVLV 307 RVQ G KN +V D +LE V + AF S+G+RC A S + V + D F++ LV Sbjct: 241 RVQLELGGKNPLVVHDDADLELAVDIALQGAFHSTGQRCTATSRIIVDRRVHDAFVERLV 300 Query: 308 AETKKLKVGDGFHEDNYVGPLIRESHKERVLGYINSGVADGATLLVDGRKIKEEVGEGYF 367 L+VGD +GP++ E+ + L I ++GA L G ++ G+GYF Sbjct: 301 TRIAALRVGDPMDAATDMGPVVSEAQLAKDLHCIADARSEGAELAFGGGRMD---GDGYF 357 Query: 368 VGATIFDGVNQEMKIWQDEIFAPVLSIVRVKDLEEGIKLTNQSKFANGAVIYTSNGKHAQ 427 + T+F G + M+I +DE+F PV ++ L+ I + N S A + I T A+ Sbjct: 358 LEPTLFVGTDNAMRINRDEVFGPVACVIPADGLDHAIAIANDSDHALSSGIVTRGLASAE 417 Query: 428 TFRDNIDAGMIGVNVNVPAPMAFFAFAGNKASFFGDLGTNGTDGVQFYTRKK 479 TFR AG++ VN F G S +G G+ V+F+T K Sbjct: 418 TFRRRSRAGLVMVNAPTAGIDYHVPFGGRGPSGYGG-REQGSAAVEFFTEGK 468 Lambda K H 0.317 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 546 Number of extensions: 28 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 486 Length of database: 478 Length adjustment: 34 Effective length of query: 452 Effective length of database: 444 Effective search space: 200688 Effective search space used: 200688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory