Align Probable 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (uncharacterized)
to candidate AZOBR_RS26815 AZOBR_RS26815 3-hydroxyisobutyrate dehydrogenase
Query= curated2:P63936 (294 letters) >FitnessBrowser__azobra:AZOBR_RS26815 Length = 299 Score = 286 bits (733), Expect = 3e-82 Identities = 152/295 (51%), Positives = 188/295 (63%), Gaps = 4/295 (1%) Query: 1 MTTIAFLGLGNMGAPMSANLVGAGHVVRGFDPAPTAASGAAAHGVAVFRSAPEAVAEADV 60 M IAF+GLGNMG PM NL AGH V G+D P A AA G V + EA+A+AD Sbjct: 1 MARIAFIGLGNMGRPMCDNLTKAGHDVVGYDVVPAARDAYAAAGGRVASTLAEALADADT 60 Query: 61 VITMLPTGEVVRRCYTD---VLAAARPATLFIDSSTISVTDAREVHALAESHGMLQLDAP 117 VI+M+PTG+ VR Y D VLA ARP T+ ID STI V AR V A G + +DAP Sbjct: 61 VISMIPTGKHVRAAYEDEGGVLAHARPGTMLIDCSTIDVESARAVSKAAADAGFVMVDAP 120 Query: 118 VSGGVKGAAAATLAFMVGGDESTLRRARPVLEPMAGKIIHCGAAGAGQAAKVCNNMVLAV 177 VSG V A A TL FMVGG RARPVL M KI H GA+G G A K+CNNM+ + Sbjct: 121 VSGAVPAAQAGTLTFMVGGTAEGFERARPVLTAMGPKIFHVGASGNGVALKICNNMMAGM 180 Query: 178 QQIAIAEAFVLAEKLGLSAQSLFDVITGATGNCWAVHTNCPVPGPVPTSPANNDFKPGFS 237 +AI+E F LAEKLGL Q+++DV+T ++GNCWA+ + CPVPGPVP SPAN D++PGF+ Sbjct: 181 SMVAISEVFALAEKLGLDHQTVYDVMTVSSGNCWALQSYCPVPGPVPASPANRDYQPGFA 240 Query: 238 TALMNKDLGLAMDAVAATGATAPLGSHAADIYAKFAA-DHADLDFSAVIHTLRAR 291 A+M KD+ L+ +A A +GA PL AA +Y H + DFSAV + R Sbjct: 241 AAMMLKDMRLSQNAAATSGAATPLAGSAAALYQMLVEHGHGNKDFSAVFALITGR 295 Lambda K H 0.319 0.131 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 299 Length adjustment: 26 Effective length of query: 268 Effective length of database: 273 Effective search space: 73164 Effective search space used: 73164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate AZOBR_RS26815 AZOBR_RS26815 (3-hydroxyisobutyrate dehydrogenase)
to HMM TIGR01692 (mmsB: 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01692.hmm # target sequence database: /tmp/gapView.1895909.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01692 [M=288] Accession: TIGR01692 Description: HIBADH: 3-hydroxyisobutyrate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-117 376.0 10.7 7.1e-117 375.8 10.7 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS26815 AZOBR_RS26815 3-hydroxyisobutyra Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS26815 AZOBR_RS26815 3-hydroxyisobutyrate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 375.8 10.7 7.1e-117 7.1e-117 1 286 [. 6 291 .. 6 293 .. 0.99 Alignments for each domain: == domain 1 score: 375.8 bits; conditional E-value: 7.1e-117 TIGR01692 1 fiGlGnmGgpmaanllkaghavrvfdlsakaveelveaGaqaaasaaeaveeadvvitmlPagkhvesv 69 fiGlGnmG pm nl kagh v +d+ ++a + +aG ++a++ aea ++ad+vi+m+P+gkhv++ lcl|FitnessBrowser__azobra:AZOBR_RS26815 6 FIGLGNMGRPMCDNLTKAGHDVVGYDVVPAARDAYAAAGGRVASTLAEALADADTVISMIPTGKHVRAA 74 9******************************************************************** PP TIGR01692 70 yagdegilakvkkksllidsstidvdsarkvaeeaaakGavfldaPvsGGvggaraGtltfmvGgeaee 138 y + g+la+++ +++lid+stidv+sar+v+++aa++G+v++daPvsG v +a+aGtltfmvGg+ae lcl|FitnessBrowser__azobra:AZOBR_RS26815 75 YEDEGGVLAHARPGTMLIDCSTIDVESARAVSKAAADAGFVMVDAPVSGAVPAAQAGTLTFMVGGTAEG 143 **99***************************************************************** PP TIGR01692 139 faraepvleamgknivhaGdaGaGqaakiCnnlllgismiGvaealalgeklGldpkvlaeilskssGr 207 f+ra+pvl+amg +i+h+G++G G a kiCnn++ g+sm+ ++e +al+eklGld++++ +++ ssG+ lcl|FitnessBrowser__azobra:AZOBR_RS26815 144 FERARPVLTAMGPKIFHVGASGNGVALKICNNMMAGMSMVAISEVFALAEKLGLDHQTVYDVMTVSSGN 212 ********************************************************************* PP TIGR01692 208 cWsldtynPvPGvveqaPasngykgGfatalmlkdlglaqeaaksvkasvllGalarelyslfaskgag 276 cW+l++y+PvPG+v+++Pa+++y++Gfa+a+mlkd++l+q+aa++ +a ++l a +ly++ ++g+g lcl|FitnessBrowser__azobra:AZOBR_RS26815 213 CWALQSYCPVPGPVPASPANRDYQPGFAAAMMLKDMRLSQNAAATSGAATPLAGSAAALYQMLVEHGHG 281 ********************************************************************* PP TIGR01692 277 kkdfsavikl 286 +kdfsav+ l lcl|FitnessBrowser__azobra:AZOBR_RS26815 282 NKDFSAVFAL 291 *******987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (288 nodes) Target sequences: 1 (299 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 24.76 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory