Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate AZOBR_RS00060 AZOBR_RS00060 sn-glycerol-3-phosphate ABC transporter ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >FitnessBrowser__azobra:AZOBR_RS00060 Length = 357 Score = 336 bits (862), Expect = 5e-97 Identities = 178/356 (50%), Positives = 240/356 (67%), Gaps = 19/356 (5%) Query: 1 MAGIKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRI 60 MA + ++++ K YG +A+ I++ + DGEF+V +GPSGCGKSTLLR +AGLE ++ G I Sbjct: 1 MATVDLNQVRKSYGAVEAIKGIDISVADGEFLVLLGPSGCGKSTLLRMVAGLESITGGEI 60 Query: 61 EIGGRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARV 120 IGGR V +EP DRD+AMVFQ+YALYPHM+V +NM +G+K+ G + R+A+AA + Sbjct: 61 AIGGRVVNGLEPKDRDIAMVFQNYALYPHMSVFDNMAYGLKIRGLPKAEIQARVAKAAEI 120 Query: 121 LQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLH 180 L+L +LDR+P QLSGGQRQRVA+GRAIV+ P+ FLFDEPLSNLDAKLR QMRVE++ L Sbjct: 121 LELNRFLDRRPSQLSGGQRQRVAMGRAIVREPAAFLFDEPLSNLDAKLRTQMRVEIKRLQ 180 Query: 181 KQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGSPAMN 240 +LG T +YVTHDQVEAMT+AD+I+V+N G EQVG+P+++Y +P S FVA FIGSP MN Sbjct: 181 DRLGITSLYVTHDQVEAMTLADRILVMNHGVAEQVGTPLEVYQRPASLFVAGFIGSPPMN 240 Query: 241 VFSS--DVGLQDISLDASAAF---------------VGCRPEHIEIVPDGDGHIAATVHV 283 V + D Q ++L AF +G RPEH+ + P G G + TV Sbjct: 241 VLDARFDGAGQAVALPGGTAFLLPRPRPDMAGRPVKLGVRPEHLAVTP-GHGPLIVTVDX 299 Query: 284 KERLGGESLLYLGLKGGGQIVARVGGDDETKVGAAVSLRFSRHRLHQFD-EAGRAI 338 E LG ++++Y L G +V RV G + G + + LH FD E GR + Sbjct: 300 VEALGADTVVYGRLPDGEGMVVRVAGLPFCREGETLRVGAPPDALHLFDAETGRRL 355 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 357 Length adjustment: 29 Effective length of query: 309 Effective length of database: 328 Effective search space: 101352 Effective search space used: 101352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory