Align ABC transporter for Xylitol, permease component 1 (characterized)
to candidate AZOBR_RS25585 AZOBR_RS25585 ABC transporter permease
Query= reanno::Dino:3607126 (288 letters) >FitnessBrowser__azobra:AZOBR_RS25585 Length = 301 Score = 143 bits (361), Expect = 4e-39 Identities = 92/276 (33%), Positives = 151/276 (54%), Gaps = 13/276 (4%) Query: 7 RKTVFAFIGPAVIGLALVGIAPLLYALWTSLHFYNLTKLRRVEFIGLENYWTVLTDEVFW 66 R+ + F+ P +I LA V PL ++ S L L + +GL+NY ++ D V+W Sbjct: 15 RRAAWLFLLPMLIVLAGVAGWPLFRTVFFSFTDATLATLEGFQGVGLDNYLWLMRDPVWW 74 Query: 67 QAMGRTFFLLGTALPLQIALGLGIALVL--HQPGLTLVKTLARLSLVLPMATTYAVVGLL 124 +A+ T ++ ++ ALGLGIAL+L H PG + L R ++++P A V + Sbjct: 75 RAVWNTLVFTVVSVGIETALGLGIALILNAHLPG----RGLLRAAVLIPWAIPTVVSAQM 130 Query: 125 GQVMFNQKFGVVNQLLGGADI-----NWIGDPENAFAMIIFWDVWQWTPFVALVLLAGLT 179 MF+ +GVVN +L G + W DP+ A ++I DVW+ TPF+AL++LA L Sbjct: 131 WGWMFHDLYGVVNAILMGLGLIAEPRAWTADPDLALPVVIAVDVWKSTPFMALLILAALQ 190 Query: 180 MVPGEVEEAARLETKSKWTVLRYVQLPFLLPGLVAVLILRTADTLKLFDMVFTLTRGGPG 239 M+P ++ EAAR++ V + LP + P L+ ++ RT D L++FD+++ LT G Sbjct: 191 MLPRDLYEAARVDGVHPVKVFVRITLPLIRPALMVAVLFRTLDALRVFDLMYVLT--GNS 248 Query: 240 SSTEFISLMIQRVGFRGFDQGLASAQAIILLIITIV 275 ST +S+ ++ D G SA A +L+++ V Sbjct: 249 RSTMSMSVYARQYLIDFQDVGYGSAAATLLVLVLAV 284 Lambda K H 0.329 0.144 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 301 Length adjustment: 26 Effective length of query: 262 Effective length of database: 275 Effective search space: 72050 Effective search space used: 72050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory