Align ABC transporter for Xylitol, permease component 1 (characterized)
to candidate AZOBR_RS27990 AZOBR_RS27990 ABC transporter permease
Query= reanno::Dino:3607126 (288 letters) >FitnessBrowser__azobra:AZOBR_RS27990 Length = 310 Score = 121 bits (304), Expect = 2e-32 Identities = 89/290 (30%), Positives = 147/290 (50%), Gaps = 7/290 (2%) Query: 4 QVPRKTVFAFIGPAVIGLALVGIAPLLYALWTSLHFYNLTKLRRVEFIG--LENYWTVLT 61 Q R+ A + PA++ L + + P L+ L SL +L V L NY +L Sbjct: 20 QTRRRAYLAGLLPALVVLGGITLLPGLFLLGVSLTPLSLVNPGTVFDFSDPLGNYRELLR 79 Query: 62 DEVFWQAMGRTFFLLGTALPLQIALGLGIALVLHQPGLTLVKTLARLSLVLPMATTYAVV 121 D F ++ L T++ LQ+A GLG+AL+L+ R + ++PM VV Sbjct: 80 DARFHNSVLLQLHLSATSVGLQLAAGLGVALLLNVRARFF--EAIRAAFLIPMVLPPIVV 137 Query: 122 GLLGQVMFNQKFGVVNQLLGGADI---NWIGDPENAFAMIIFWDVWQWTPFVALVLLAGL 178 L+ ++++ +++LL A + + I DP A I + WQW PF L++LA L Sbjct: 138 ALIWKILYTPDVSPLHRLLEEAGLPVDSLITDPTLAIWAIAVAETWQWFPFTMLMVLATL 197 Query: 179 TMVPGEVEEAARLETKSKWTVLRYVQLPFLLPGLVAVLILRTADTLKLFDMVFTLTRGGP 238 ++P E EAAR++ ++ V R++ L +L P LV + R D+LK F +++ LT GGP Sbjct: 198 QLIPDEPLEAARIDGANRRQVFRHIILAYLRPALVVCGLFRLIDSLKAFPLIYVLTNGGP 257 Query: 239 GSSTEFISLMIQRVGFRGFDQGLASAQAIILLIITIVLAQIYIRVFYKEV 288 G++TE + F G ASA A+++L ++ + R+ + EV Sbjct: 258 GTATEVTNYYGFIEAFNFSYWGYASAIAVLMLGGVFAVSWLVGRLGWNEV 307 Lambda K H 0.329 0.144 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 310 Length adjustment: 27 Effective length of query: 261 Effective length of database: 283 Effective search space: 73863 Effective search space used: 73863 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory