Align ABC transporter for Xylitol, permease component 2 (characterized)
to candidate AZOBR_RS25590 AZOBR_RS25590 sugar ABC transporter permease
Query= reanno::Dino:3607127 (272 letters) >FitnessBrowser__azobra:AZOBR_RS25590 Length = 277 Score = 177 bits (449), Expect = 2e-49 Identities = 103/265 (38%), Positives = 156/265 (58%), Gaps = 7/265 (2%) Query: 13 LLVL-IITVCVFPFYWMVTTSLKTQIVALEAPPVWIFEPTLSNYREALFEDGVLRTLINS 71 LLVL I+ VFPF W + TSLK AL W +P+L+NY E R ++NS Sbjct: 14 LLVLGIVAWAVFPFAWAIVTSLKAGS-ALFTVEAWPSQPSLANYAAIFKEQPFGRNILNS 72 Query: 72 LIIAISTTFLALVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIVLALPFFLIARNLG 131 L+ A + L+L L V AA+AL R FRG+ L F + M + + F + R LG Sbjct: 73 LLAASAVVALSLGLAVLAAYALGRVRFRGRGLLLFVVLGVSMFPQVAVLSGLFELVRWLG 132 Query: 132 LLDKHITLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFTIMRKICLPLAMP 191 L ++ +L+L YL F LP +W++T R +P +L+EAA ++GA F I+ ++ LPL P Sbjct: 133 LYNRIGSLVLSYLIFTLPFTVWVLTTFMRELPKELEEAAMVDGAGPFVIVTRVFLPLMGP 192 Query: 192 GVAVSAIFSFIFSWNELMFGLILT-RSEAKTAPAMAVSFMEG---YNLPYGKIMATSTLI 247 +A + + +FI +WNE +F L T +A+T P +A++ M G Y LP+G+IMA S ++ Sbjct: 193 ALAATGLLAFIAAWNEFLFALTFTLTDDARTVP-VAIALMSGASQYELPWGQIMAASVVV 251 Query: 248 VIPVLIFALIASKQLVRGLTMGAVK 272 +P++ L+ +++V GLT GAVK Sbjct: 252 TVPLIGLVLLFQRRIVSGLTAGAVK 276 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 277 Length adjustment: 25 Effective length of query: 247 Effective length of database: 252 Effective search space: 62244 Effective search space used: 62244 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory