Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate AZOBR_RS25590 AZOBR_RS25590 sugar ABC transporter permease
Query= uniprot:D8IPH9 (270 letters) >FitnessBrowser__azobra:AZOBR_RS25590 Length = 277 Score = 129 bits (324), Expect = 7e-35 Identities = 82/267 (30%), Positives = 137/267 (51%), Gaps = 3/267 (1%) Query: 3 RLITRCAVWGVGIVLVLVAVFPLLWALLNSVKTLLDIVTPTPRFLFTPTLENYRQVIGSP 62 R+I R A + + +V AVFP WA++ S+K + T + P+L NY + Sbjct: 5 RMIGRIAFGLLVLGIVAWAVFPFAWAIVTSLKAGSALFT-VEAWPSQPSLANYAAIFKEQ 63 Query: 63 EVLVGLTNSAVIVGSAVLLGTFMGVPAAYVIARYHVPGKRDIQFFLLSLRFLPPVAVAIP 122 + NS + + V L + V AAY + R G+ + F +L + P VAV Sbjct: 64 PFGRNILNSLLAASAVVALSLGLAVLAAYALGRVRFRGRGLLLFVVLGVSMFPQVAVLSG 123 Query: 123 LIAIWVDLGLYDTRFSMIVTYLLTTLSTITWLSIPVFQRMPREIEEAATLDGYGPYAVFW 182 L + LGLY+ S++++YL+ TL W+ + +P+E+EEAA +DG GP+ + Sbjct: 124 LFELVRWLGLYNRIGSLVLSYLIFTLPFTVWVLTTFMRELPKELEEAAMVDGAGPFVIVT 183 Query: 183 KIALPNCATTLLGGIIFSFVLVWNELMIALALTSSNSA-TLPVVASAFTSMGQ-EVPWGV 240 ++ LP L + +F+ WNE + AL T ++ A T+PV + + Q E+PWG Sbjct: 184 RVFLPLMGPALAATGLLAFIAAWNEFLFALTFTLTDDARTVPVAIALMSGASQYELPWGQ 243 Query: 241 INASTVLLALPPLIFVGVLSRLLNSML 267 I A++V++ +P + V + R + S L Sbjct: 244 IMAASVVVTVPLIGLVLLFQRRIVSGL 270 Lambda K H 0.327 0.142 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 270 Length of database: 277 Length adjustment: 25 Effective length of query: 245 Effective length of database: 252 Effective search space: 61740 Effective search space used: 61740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory