Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate AZOBR_RS27985 AZOBR_RS27985 ABC transporter permease
Query= uniprot:D8IPH9 (270 letters) >FitnessBrowser__azobra:AZOBR_RS27985 Length = 280 Score = 132 bits (333), Expect = 6e-36 Identities = 75/257 (29%), Positives = 127/257 (49%), Gaps = 4/257 (1%) Query: 7 RCAVWGVGIVLVLVAVFPLLWALLNSVKTLLDIVTPTPRFLFTPTLENYRQVIGSPEVLV 66 R + + L+L+ +FP W + +++ ++ LF PTLEN+ + Sbjct: 17 RIGLHAAALALLLLVLFPFAWMVQMALRPADAVLDDA--VLFLPTLENF-VALWQGHFPK 73 Query: 67 GLTNSAVIVGSAVLLGTFMGVPAAYVIARYHVPGKRDIQFFLLSLRFLPPVAVAIPLIAI 126 NS ++ + +GVPAAYV+ R+ +R + ++L+ R PP+A+ IP Sbjct: 74 SFLNSVLVSSLSTAASLALGVPAAYVLTRWRFRARRRVALWILATRMAPPIALTIPFFLA 133 Query: 127 WVDLGLYDTRFSMIVTYLLTTLSTITWLSIPVFQRMPREIEEAATLDGYGPYAVFWKIAL 186 + +GL D+ + + Y+ +S + W F +PR +EEAA +DG G + F ++ L Sbjct: 134 YRWVGLQDSVVGLALIYMTFNISIVVWFMQTFFAAIPRSLEEAAWIDGCGVWQAFRRVTL 193 Query: 187 PNCATTLLGGIIFSFVLVWNELMIALALTSSNSATLPVVASAFTSMGQEVPWGVINASTV 246 P A L +F F+ WN+ AL LT +N+ T PV + F + WG I A+ Sbjct: 194 PLAAPGLAATAVFCFIFSWNDFFFALILTRTNAVTAPVAITNFLQY-EGWEWGKIAAAGT 252 Query: 247 LLALPPLIFVGVLSRLL 263 L+ LP L F ++ + L Sbjct: 253 LVMLPVLAFTLLVRKYL 269 Lambda K H 0.327 0.142 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 270 Length of database: 280 Length adjustment: 25 Effective length of query: 245 Effective length of database: 255 Effective search space: 62475 Effective search space used: 62475 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory