Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate AZOBR_RS27940 AZOBR_RS27940 ABC transporter permease
Query= uniprot:A0A1N7UKA9 (325 letters) >FitnessBrowser__azobra:AZOBR_RS27940 Length = 329 Score = 181 bits (460), Expect = 2e-50 Identities = 116/308 (37%), Positives = 175/308 (56%), Gaps = 12/308 (3%) Query: 22 LDRFGLPLVFILLCVVMAFSSEYFMTWRNWMDILRQTSINGILAVGMTYVILTKGIDLSV 81 L +G L L V+ + F++ N ++L +T+ GI+AVG T+VI GIDLSV Sbjct: 14 LKLYGPFLALAALIVLGTIVNPVFLSPGNIGNVLTRTAFIGIIAVGATFVITAGGIDLSV 73 Query: 82 GSILAFAG-----LCSAMVATQGYGL---LAAVSAGMFAGAMLGVVNGFMVANLSIPPFV 133 GS+ AFA + +A+V + G GL L V + G + G+VNG +V + F+ Sbjct: 74 GSLAAFASGVMIVVMNALVGSMGAGLPVILIGVLVALGLGLVAGLVNGLLVTKGRMEAFI 133 Query: 134 ATLGMLSIARGMTFILNDGSPIT---DLPDAYLALGIGKIGPIGVPIIIFAVVALIFWMV 190 TLG + I R + + DG ++ ++ Y + G + I PI+ FAVVALI ++ Sbjct: 134 VTLGTMGIFRSLVTYIADGGTLSLNSEIRTIYRPVYYGGVFGISYPILAFAVVALIGALI 193 Query: 191 LRYTTYGRYVYAVGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSARTTSALPQA 250 + T +GRY A+G +E AR S I V +V +V+ G+ +A V+ R SA Sbjct: 194 MYRTRFGRYCAAIGSSEDVARYSAINVDRVKLLAFVLQGICVAIAVVIYVPRLGSASATT 253 Query: 251 GVSYELDAIAAVVIGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLG-VSSYYQQVAKGL 309 G+ +EL+AIAAV+IGGT L GG G I GT+ GA+++ +I+N LNL G +S Y +G+ Sbjct: 254 GLLWELEAIAAVIIGGTMLKGGYGRIWGTVVGAVMLTLIDNILNLTGAISVYLNGTIQGV 313 Query: 310 IIVFAVLI 317 II+ AVL+ Sbjct: 314 IIIVAVLL 321 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 329 Length adjustment: 28 Effective length of query: 297 Effective length of database: 301 Effective search space: 89397 Effective search space used: 89397 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory