Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate AZOBR_RS31200 AZOBR_RS31200 sugar ABC transporter permease
Query= uniprot:A0A1N7UKA9 (325 letters) >FitnessBrowser__azobra:AZOBR_RS31200 Length = 325 Score = 165 bits (417), Expect = 2e-45 Identities = 106/297 (35%), Positives = 166/297 (55%), Gaps = 13/297 (4%) Query: 29 LVFILLCVVMAFSSEYFMTWRNWMDILRQTSINGILAVGMTYVILTKGIDLSVGSILAFA 88 +V LLC A F + R ++L + GI AVGMT+VIL+ GIDLSVG+++ F Sbjct: 16 VVGFLLC---AAQFPNFASLRVVGNLLTDNAFLGITAVGMTFVILSGGIDLSVGAVIGFT 72 Query: 89 GLCSAMVATQG-YGLLAAVSAGMFAGAMLGVVNGFMVANLSIPPFVATLGMLSIARGMTF 147 + A++ QG + ++A + + G G ++ +PPF+ TL + +ARG+ F Sbjct: 73 TVLLAVLIEQGGWHPVSAFAVALAVAGGFGAAMGAVIHVFQMPPFIVTLAGMFVARGLGF 132 Query: 148 ILN-DGSPIT-----DLPDAYLALGIGKIGPIGVPIIIFAVVALIFWMVLRYTTYGRYVY 201 +L+ D PI +L D LAL G + +P ++ V + +T +G +Y Sbjct: 133 VLSTDSIPINHPLYAELGD--LALRFDGGGKLTLPALLMLGVVAAAVVCAHWTRFGANLY 190 Query: 202 AVGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSARTTSALPQAGVSYELDAIAA 261 A+GGN +SA G+ V + +VY +SGLLAGLAG+V S T + A ELD I A Sbjct: 191 ALGGNRQSAELMGVPVGRTTVAVYALSGLLAGLAGIVFSLYTGAGYSLAATGVELDTITA 250 Query: 262 VVIGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLG-VSSYYQQVAKGLIIVFAVLI 317 VVIGGT L+GG G ++GT G L+ G+I + G +SS++ ++A G+++ +L+ Sbjct: 251 VVIGGTQLTGGYGYVIGTFIGVLIQGLIQTYITFDGSLSSWWTKIAIGVLLFVFILL 307 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 325 Length adjustment: 28 Effective length of query: 297 Effective length of database: 297 Effective search space: 88209 Effective search space used: 88209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory